KEGG   Serratia sp. AS12: SerAS12_1601Help
Entry
SerAS12_1601      CDS       T01502                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
srs  Serratia sp. AS12
Pathway
srs00550  Peptidoglycan biosynthesis
srs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SerAS12_1601
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:srs01002]
    SerAS12_1601
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:srs01011]
    SerAS12_1601
Enzymes [BR:srs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SerAS12_1601
Peptidases [BR:srs01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SerAS12_1601
Peptidoglycan biosynthesis and degradation proteins [BR:srs01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SerAS12_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AEF49686
LinkDB All DBs
Position
1731008..1732213
Genome map
AA seq 401 aa AA seqDB search
MMKKNLSTSLKKLTFSVSILLLATPALQAAEAPAAPQVDAKAFVLMDYNSGKILTEGNAD
TRLDPASLTKIMSSYVIGQAIKAGKIKPEDMVTVGKDAWATGNPALRGSSLMFIKPGDQV
PVMELNKGIVIQSGNDASIALADYVAGSQDSFVGLMNNYAKSLGLQNTHFLTVHGLDAEG
QYSTARDMALLSQALIRDVPDEYALHKEKDFTFNKIRQVNRNRLLWSSNLNVDGIKTGYT
GGAGHNLVASATDGPMRLISVVLGAPSDRIRFSESEKLLTWGFRFYETATPIKTDKPFVT
QRVWFGEINDVPLGVAKDAAVTIPKGQMKNLKASYKLNQPTLEAPLVKNQVVGTIDFQLD
GKTIEQYPLVVMQEVKEGNFFSRIWDMVMMKLTQWFGSVFG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaaacttatccacctccctgaagaaattgacctttagcgtcagcattttg
ttgttggctacacctgcgctccaggcagccgaagcgccggcggccccgcaggttgacgcc
aaggcgtttgtgctgatggattacaacagcggcaaaatcctgacggagggcaatgccgat
acccggctcgatcccgccagcctgaccaagatcatgtccagctatgtgattggccaggcc
atcaaggccggcaagatcaagccggaggacatggtcaccgtcggtaaggacgcctgggca
accggcaatccggcgctgcgcggctcttcgctgatgtttatcaaaccgggcgatcaggtg
ccggtaatggaactgaacaagggcatcgtcattcagtcgggcaatgatgccagcatcgcg
ctggccgattatgtcgcaggcagccaggattcgttcgtcggcctgatgaacaactacgcc
aaatcactgggtttgcagaatacccatttcctgacggtgcatggcctggatgcggaaggg
cagtacagcaccgcacgtgatatggcgctgctgagccaggcgctgatccgtgacgtgccg
gatgagtatgcgctgcataaggaaaaagatttcaccttcaacaagatccgtcaggttaac
cgcaaccgcctgctgtggagctccaacctgaatgtcgacggcatcaaaaccggctacacc
ggtggtgccggccataacctggtggcatccgctaccgacggcccgatgcgcctgatctcg
gtggtgctgggcgcgccgagtgaccgtattcgtttcagcgaaagtgaaaaactgctgacc
tggggtttccgcttctacgaaacggccacgccgatcaagaccgacaagccgtttgtcacc
cagcgcgtgtggttcggtgaaatcaacgacgtgccgctgggcgtcgccaaagatgcggcg
gtcactatcccgaaagggcagatgaaaaatctgaaagccagttacaaactgaatcagccc
acgttggaagcgccgctggtgaaaaaccaggtggtgggcaccattgacttccagcttgac
ggtaaaaccattgagcaatacccactggtggtgatgcaggaagtgaaagaaggcaacttc
ttcagccgcatttgggacatggtgatgatgaagctgacccagtggttcggtagcgtcttc
ggttaa

DBGET integrated database retrieval system