KEGG   Serratia sp. AS12: SerAS12_3875Help
Entry
SerAS12_3875      CDS       T01502                                 

Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
srs  Serratia sp. AS12
Pathway
srs03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:srs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SerAS12_3875
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:srs03400]
    SerAS12_3875
Enzymes [BR:srs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SerAS12_3875
DNA repair and recombination proteins [BR:srs03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SerAS12_3875
 Prokaryotic type
     SerAS12_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Tox-HDC
Motif
Other DBs
NCBI-ProteinID: AEF51927
LinkDB All DBs
Position
4147662..4148345
Genome map
AA seq 227 aa AA seqDB search
MSTSLTWHDVIGKEKEQPYFHETLAFVAAERQAGKTIYPPQKDVFNAFRYTELADVKVVI
LGQDPYHGPNQAHGLSFSVLPGVPAPPSLVNMYKELATDIPGFERPSHGCLQSWAEQGVL
LLNTVLTVERGQAHSHAKLGWETFTDRVIAALNDNREGVVFLLWGSHAQKKGNIIDSKRH
HVLKAPHPSPLSAHRGFLGCRHFSQANQLLEQQGLKPIDWLPQLPQA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctccctcacctggcatgacgtcatcggcaaggaaaaagagcaaccctatttt
catgaaacgcttgcctttgttgccgctgaacgccaggccggtaagaccatttatccacca
caaaaagacgtgttcaacgccttccgctataccgaactggcggacgtgaaagtggtgatc
ctcggccaggatccttatcacggcccgaatcaggcccacggcctttctttctcggtgctt
cccggcgtgccggcgcccccttcgctggtcaacatgtataaagaattggcgacggatatc
ccgggatttgagcggccaagccacggctgcctgcaaagctgggcggaacagggcgtgctg
ctgctgaacacggtattgaccgttgaacgcggccaggcgcattcccacgcaaaactgggt
tgggaaacctttacggatagagtgatcgccgcactgaatgacaaccgcgaaggcgtggtg
tttctgctgtggggctcgcatgcccaaaagaaaggcaacattatcgacagcaagcgccac
cacgtgctgaaagcgccgcatccttcgccgctctcggcccaccgcggcttcctcggttgt
cgccatttctcgcaggccaatcaactgctggaacaacaggggctgaaacctatcgactgg
ctgccgcaactgccgcaggcataa

DBGET integrated database retrieval system