KEGG   Serratia sp. AS12: SerAS12_4415Help
Entry
SerAS12_4415      CDS       T01502                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
srs  Serratia sp. AS12
Pathway
srs00250  Alanine, aspartate and glutamate metabolism
srs00410  beta-Alanine metabolism
srs00640  Propanoate metabolism
srs00650  Butanoate metabolism
srs01100  Metabolic pathways
srs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SerAS12_4415
   00650 Butanoate metabolism
    SerAS12_4415
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SerAS12_4415
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SerAS12_4415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srs01007]
    SerAS12_4415
Enzymes [BR:srs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SerAS12_4415
Amino acid related enzymes [BR:srs01007]
 Aminotransferase (transaminase)
  Class III
   SerAS12_4415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEF52460
LinkDB All DBs
Position
complement(4767351..4768616)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEQQLKAFTHTAYQIVPYESYVSLAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRADVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARKTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgtcaggatgccaccccacgggggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaatgccacgctgtgggacgtagaaggcaat
gaggtgatcgatttcgcttccggtattgctgttctgaataccggacaccggcatccgaag
gtgatcgccgccattgaacagcaactgaaggccttcacccacaccgcttaccaaatcgtt
ccttacgaaagctatgtctcgttggcagagcgcatcaaccagcgcgcaccgatcgaaggc
ccctgtaaaaccgcgttgttcaccaccggcgccgaagcggtggaaaacgcggtcaaaatc
gcccgcgcctataccggccgaccgggcctgatcacctttggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggctccgtacaagctgggcttcgggccc
ttccccggttcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggagcgcatctttaaggcggatatcgatcccaaacaagtggcc
gccattgtgctggaaccggtgcagggcgagggcggtttcaacattgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggaacattacgcggtgaaaccg
gatctgatcactatggcgaaaagcctggcgggcggtatgccgctgtcggcggtggccggc
cgtgccgacgtgatggacgccccggcgccgggcgggctgggcggcacttatgccggtaac
ccgctggcggtggctgcggcacttgcggtgctggacgtgattgacgaagaacagctgtgc
cagcgttcccaacgtttgggccagcatttggtggaggtgctgcaacaggcgcgcaaaacc
agcccggcgatcgcggatattcgcgcgcagggatcgatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgctggag
gaggggctgttgctgttgagctgcggtgtgaacggtaacgtgatccgcttcctgtatccg
ctgaccatccctgaggagcagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system