KEGG   Serratia sp. AS12: SerAS12_4539Help
Entry
SerAS12_4539      CDS       T01502                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
srs  Serratia sp. AS12
Pathway
srs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS12_4539
Enzymes [BR:srs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SerAS12_4539
Transporters [BR:srs02000]
 Other Transporters
  Pores ion channels [TC:1]
   SerAS12_4539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEF52584
LinkDB All DBs
Position
complement(4904835..4905503)
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNNSRSQRILWFLEELGVPYQVQRYQRDPQTLLAPPELKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGLFIPTDHHARQQYRYWLHYAEGSLMPLQVMKLVFSRLGQ
SPVPWLLRPVAGAIGKGVQREYLDKQIATHRDYLEQHLSKSTWFVGNEFSAADIQMSFPL
EAMAARGSLDNCPKLRGYLQRIHSRPAYQRALEQGGPYELLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtgcaccatctgaataattcacgctcgcagcgcatcctgtggtttctggag
gagctgggtgtgccgtaccaggtgcagcgttaccagcgcgacccgcaaaccctgctggcg
ccgccggagttgaaaaagatccacccgttgggcaaatccccggtgattgtcgatggcgat
ctgaccctggcggaatccggcgccattatcgaatatttgcaagaagcctacgatgcccag
ggattgtttatcccgactgaccatcatgctcgccaacaataccgttactggctgcattat
gcggaaggatcgctgatgccgctgcaggtcatgaagctggtgttcagccgcctgggtcaa
tcgccggtcccctggctgttgcggccggtagcaggggcgattggcaaaggggttcagcgg
gagtatctggacaaacagatcgctacgcatcgcgattatcttgagcagcacctgagcaaa
agcacctggtttgtcggcaatgaattcagcgcggcggatatccagatgagctttccgctg
gaagcgatggcggcgcgcggttcgctggacaattgcccgaagctgcgcggttatctgcag
cgtattcattcccggccagcctaccagcgggcgctggagcagggcggcccttatgaattg
ctgagctga

DBGET integrated database retrieval system