KEGG   Segniliparus rotundus: Srot_0273Help
Entry
Srot_0273         CDS       T01238                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
srt  Segniliparus rotundus
Pathway
srt00250  Alanine, aspartate and glutamate metabolism
srt00410  beta-Alanine metabolism
srt00430  Taurine and hypotaurine metabolism
srt00650  Butanoate metabolism
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt02024  Quorum sensing
Module
srt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:srt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Srot_0273
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Srot_0273
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Srot_0273
   00430 Taurine and hypotaurine metabolism
    Srot_0273
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Srot_0273
Enzymes [BR:srt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Srot_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADG96760
UniProt: D6ZB01
LinkDB All DBs
Position
247386..248735
Genome map
AA seq 449 aa AA seqDB search
MSTDPAYTSWLDLQFQPPARLGDTSLDADGVARHIHDELMLDGSSRLNLATFVSTWMEPQ
AQKLMVEAFDKNMIDKDEYPATAAIETRCVSIVADLFHAPGLDPGDPGTATGVSTIGSSE
AVMLGGLALKWRWRLARERAGASTARPNLVLGSNVQVVWEKFCRYFEVEPRYLPMAPGRY
TITAEQVREAVDENTIGVVAILGTTFTGEFEPVEQIAQVLDELAASGGPDVKIHVDAASG
GFVAPFLHPELRWDFRVPRVASINVSGHKYGLTYPGVGFVVWRDREQLPEELIFRVSYLG
GDMPTFTLNFSRPGNQVIGQYYNFLRFGREGYTRIMGALQHIARWIADELAALPGVRMIA
DGSAIPVVAFALDEELGYDVYALSHALRAGGWQVPAYPMPEGAQGLSVLRIVVREGFSGE
LARALVQAVGTAMQELSQGGLKPRKQFMH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagatcccgcgtacaccagctggctcgacttgcagttccagcctcctgcgcgg
ctcggcgacaccagcctggacgccgacggcgtcgcccggcacatccatgacgagctcatg
ctcgacggttcgtcccgcttgaacctcgcgacgttcgtgagcacctggatggagccgcaa
gcccaaaagctcatggtcgaggcgttcgacaagaacatgatcgacaaggacgagtacccg
gccaccgcggccatcgagacgcggtgcgtgtccatcgtcgccgacctcttccacgccccg
gggctcgacccgggcgacccggggaccgcgaccggggtgtccacgatcgggtccagcgag
gctgtgatgctgggcgggctcgcgctgaaatggcgttggcggctcgcgcgcgagcgcgcg
ggcgcgagcacggcaaggccgaacctggtgctcgggtccaatgtgcaagtggtgtgggag
aagttctgccgctatttcgaagtcgagccccggtatctgccgatggcccccggccggtac
accatcacggcggagcaggtccgcgaggcggtggacgagaacaccatcggcgtcgtggcg
atcctcggcaccaccttcaccggcgagttcgaaccggtcgagcagatcgcccaggtcctc
gacgagcttgctgcttcgggcgggccggacgtcaagatccatgtggacgcggcgagcggg
ggtttcgtcgccccgttcctgcatccggagctgcgctgggacttccgcgtgcccagggtc
gcgtcgatcaacgtgtccgggcacaaatacgggctcacgtaccccggcgtcgggttcgtc
gtgtggcgggaccgggagcagctgccggaagagctgattttccgggtctcctacctcggc
ggcgacatgccgacgttcaccttgaacttttcccgccccggcaaccaagtgatcggccag
tactacaactttttgcgcttcggacgcgagggctacacgcggatcatgggcgcgttgcag
cacatcgccaggtggatcgccgacgagctcgccgcgctgcccggcgtgcgaatgatcgcc
gacggctccgcgatccccgtggtggcgttcgctttggacgaggaactgggctacgacgtg
tacgcgctctcgcacgcgttgcgcgccgggggctggcaggtgcccgcctacccgatgccc
gagggcgcgcaagggctgtcggtgctgcggatcgttgtgcgggaagggttcagcggcgaa
ctcgcccgagcgctggtccaggcggtggggacagcgatgcaggagctttcccaaggcggg
ctgaagcccaggaagcagttcatgcactga

DBGET integrated database retrieval system