KEGG   Segniliparus rotundus: Srot_0759Help
Entry
Srot_0759         CDS       T01238                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srt  Segniliparus rotundus
Pathway
srt00564  Glycerophospholipid metabolism
srt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Srot_0759
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Srot_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox AlaDh_PNT_C HI0933_like Thi4
Motif
Other DBs
NCBI-ProteinID: ADG97238
UniProt: D6ZDH4
LinkDB All DBs
Position
complement(747068..748822)
Genome map
AA seq 584 aa AA seqDB search
MKNPPAKNLMAHQLGPEQRAAAWEQLGNQHFDVVVVGGGVVGAGAALDAATRGLSVALIE
ARDWASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELMMTKIAPHLVKPQAFIAPLS
HRVWERPYMAAGFFLYDTMGGAKSVPRQRHYTRAGTLRMAPSLRSDALVGAVRYYDTVTD
DARHTLTVARTAAHFGAVARTSTQAVGFVQDGGRVRGVQVRDSESGETAEVRGHVVVNCS
GVWTTELQKAAGIRGRFQVRASKGVHIVVPRDKIISDVALILRTPTSVLYAIPWRERWLI
GTTDTDWKLDLAHPAATRADIEYILSQINRVLKVPLTAQDIDGVYAGLRPLLAGEDEATS
KLSREHAVATDAPGLVCIAGGKYTTYRVMAKDAIDAAVPFLPAGAPESVTENVPLLGADG
YPALKNKAHSIGQDWDLPHDRVMGLLDRYGSMLPEVLALADEDPSLLRPVRDASDYLRAE
IKYACVAEGALHLEDLLARRTRISIEYAHRGVACAREAAEIAAGVLGWDEQRAKAEIELY
TARVEAELRSQSLTDDAAADALRAGAPESRGEILEPVPAAGLPS
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccccccgcgaaaaacctcatggcccatcagctcggccccgagcaacgagca
gcggcctgggagcaactgggcaaccagcacttcgacgtggtggtggtcggcggcggcgtc
gtcggagcgggcgcggccctggacgcggcgacacgcgggctctccgtcgccctcatcgag
gcgagggactgggcttccggcacctccagccggtcctcgaaaatgttccacggcggcctg
cgctatctcgaacagctggaattcgggctggtgcgcgaggcgttgcacgagcgcgagctg
atgatgaccaagatcgctccgcacctggtgaagccgcaagcgttcatcgccccgctctcg
caccgagtgtgggagcggccctacatggccgccgggttcttcctctacgacacgatgggc
ggcgcgaagtccgtcccccggcaacggcactacaccagggcggggacgctgcgcatggct
ccgagcttgcgctctgacgccttggtcggagcggtccgctactacgacaccgtcaccgac
gacgcccggcacaccctcaccgtcgcgcgcacagcggcgcatttcggcgcggtggcgcgc
acatcgacgcaagcggtcggcttcgtccaggacggcggccgcgtgcgcggcgtccaggtc
cgcgacagcgagtccggcgagacggccgaagtccgggggcatgtcgtggtgaactgctcg
ggcgtgtggaccacggagctgcagaaagcggcgggcatccggggccggttccaggtgcgc
gccagcaaaggcgtgcacatcgtggttccccgcgacaaaatcatcagcgacgtcgcgctc
attctgcgcaccccgacgagcgtgctctacgccatcccgtggcgggagcgctggctcatc
gggaccacggacacggattggaagctcgacctcgcccatcccgcggccacccgagccgac
atcgagtacatcctcagccaaatcaaccgggtgctgaaagtccccctcaccgcgcaggac
atcgacggggtgtacgccgggctgcgcccgctcctggcaggcgaggacgaagcgacgtcg
aagctgtccagggagcacgccgtggcgaccgacgcgccgggcctcgtctgcatcgcgggc
ggcaagtacaccacctaccgggtgatggccaaggacgccattgacgccgccgtgcccttc
ctgcccgccggagcgcccgaatcggtcaccgagaacgtgccgttgctcggcgcggacggc
tatccggccttgaagaacaaagcccacagcatcgggcaggactgggatcttccgcacgac
cgcgtgatgggcctgttggaccgctacgggtcgatgctgccggaagtgctcgcgctcgcc
gacgaggacccgagcctcttgcgcccggtccgcgacgcctcggactacctgcgggcggag
atcaagtacgcctgcgtcgcagaaggagccttgcacttggaagacctccttgcccgccgc
acccggatcagcatcgaatacgcccaccggggcgtcgcctgcgccagggaggccgccgag
atcgcggccggggtcttgggctgggacgagcagcgcgcaaaagcggagatcgagctgtac
acggcgcgggtggaggcggagctgcgctcgcaatccctcaccgacgacgccgcggcggac
gcgttgcgcgcgggcgcgccggaatccaggggcgaaatcctcgaacccgtgccagccgca
gggctgcccagttga

DBGET integrated database retrieval system