KEGG   Segniliparus rotundus: Srot_3008Help
Entry
Srot_3008         CDS       T01238                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
srt  Segniliparus rotundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ADG99435
UniProt: D6ZEF9
LinkDB All DBs
Position
3099039..3100820
Genome map
AA seq 593 aa AA seqDB search
MGPPPEKQAMTTTRRGTALKNATGFTDYLTTVRAWADTRPEHVAVGFLTEKSGRLEAQEW
SYRELLSRGDAVAAQLREEHQPGETALLLYPPGLSFVAAFFGCLASGVIAVPAPIPDGRD
KAKERLAGIVADSGARTILTDTTTAALLAGWAATLPGKVRVRPTDSIPADRGGSFEPLAA
KPSDIAFLQYTSGSTSDPKGVMVTRGNLAHNVREIQRSVHSSEDTSMVSWLPQFHDMGLI
GMILHPLFIGGSSRFLSPVTFIKRPIQWIRAMSDHAATFAMVPNFAFDLVARRYNADDFD
GVDLSSVRYIFNGSEPVQLESMRRFTELLSPKGLAPNAVLPVYGLAEATLFVTATSPGTA
AVRASVDRDALADNRLVLVPADEPNARVLVASGHPQSLEVIVVDADGWRLGDGRVGEIWI
RGESVAAGYWNRPELSAHTFGASPVGETGGWLRTGDLGALLGGELFITGRVKDVIIVNGR
NLHAHDIEAAARSAAPELARGVGAAFAVGSPERLVLVHEIRPEDIESRSPDDVAASVRTA
IFADFATPLSDCLLVPKGSVSRTTSGKIRRSHMRELYENGQLQPFAEAANEHV
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
ttgggccctccgccagaaaaacaggcaatgacgaccacgagaaggggaacggcattgaaa
aacgcaaccggtttcaccgactatctcacgaccgtgcgggcatgggcggacactcggcca
gagcatgtggcagtcggatttttgacagaaaaaagcgggcggctcgaggcgcaggaatgg
tcgtaccgcgagctcctctcccgcggcgacgctgttgccgcgcagctgcgcgaagaacac
cagcctggcgagacagcactcctgctgtatccgccgggcctctccttcgtcgcagcgttc
ttcggctgcttggcttccggcgtcatcgcagtgccggcgcccatccctgacggcagggac
aaagccaaagagcgcctcgcgggcatcgtcgccgattccggggcgcggaccatcctcacc
gacacgacgaccgccgccctcctcgccggatgggctgcaaccttgcccggcaaggtgcgc
gtccgcccgactgattcgatcccagccgaccgaggcggcagcttcgagcctcttgcggcg
aagccgtccgacatcgcgttcctccagtacacctccgggtcgacgagcgacccgaaggga
gtgatggtcaccagggggaacctggcgcacaatgtgcgggagatccaaagatccgtccat
tcctccgaagacacctcgatggtcagctggctgccccagttccacgacatgggcctgatc
ggcatgatcctgcatcccctgttcatcggcgggagctcgcgtttcctctcccctgtcacg
ttcatcaaacggccgatccaatggatccgcgcgatgtcggaccacgcggcgactttcgca
atggtgccgaacttcgccttcgacttagtcgcccgccgctacaacgccgacgatttcgac
ggcgtcgacctctccagcgtccgctacatcttcaacggctccgaacccgtgcagctcgaa
tccatgcggcggttcaccgagctgctgtcccccaaggggctcgcgccgaacgcggtgctg
ccggtctacggcctcgccgaagccaccctgttcgtcactgccacatcgcctgggaccgcc
gcggtccgcgcaagcgtggaccgcgacgcgctggccgacaaccgactggtcctcgtcccc
gccgacgagcccaacgcccgcgtcctcgtcgcgagcgggcacccgcagagcctcgaagtg
atcgtggtcgacgcggacggctggcggctgggagacggccgcgtcggcgagatctggata
cgcggcgaaagcgtcgccgctggttactggaaccgccccgaactctcggcgcacacgttc
ggagccagcccggtgggagaaactggaggctggttgcgcacaggcgacctcggcgcgctg
ctcggcggcgaattgttcatcaccggcagggtcaaagacgtcatcatcgtcaacggccgc
aacctccacgcccacgacatcgaggccgccgcgcggtcagcggcccccgagctggcgcgc
ggcgtcggcgcggcgttcgccgtgggcagcccggaaagactcgtgctggtccacgaaatc
cgaccggaagacatcgaaagccgttcgcccgacgatgtcgccgcttcggtgcgaaccgcg
atttttgcggacttcgcgacaccattgagcgattgcctgctcgttcccaaaggctcggtg
tcgcggaccacgagcggcaagatccgccgttcccacatgcgcgagctctatgagaacggc
caactgcaaccgttcgccgaagcggcgaacgagcacgtctga

DBGET integrated database retrieval system