KEGG   Salinibacter ruber DSM 13855: SRU_0093Help
Entry
SRU_0093          CDS       T00312                                 

Gene name
ppc
Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00620  Pyruvate metabolism
sru00680  Methane metabolism
sru01100  Metabolic pathways
sru01120  Microbial metabolism in diverse environments
sru01200  Carbon metabolism
Module
sru_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SRU_0093 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SRU_0093 (ppc)
Enzymes [BR:sru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SRU_0093 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-GeneID: 3851345
NCBI-ProteinID: YP_444246
UniProt: Q2S6D5
LinkDB All DBs
Position
117625..120498
Genome map
AA seq 957 aa AA seqDB search
MPRWDDLDLETEGTGISKPLSRQVNLVGSMLGHIAEEQSGEALFEHVEGLRALCKAAEQE
DAPEKREEAAERIAALDQDTLERLLHVYTTFFHLVNQAEQQEIIRINRERARQSGPSEWP
LGPGDGPGADGAEPRPQSIDAAVADLKAEGYTADEVVAFFRQLDIQPTLTAHPTEARRRS
VLRKEQHIADLLSTLRRPDATPDERAETLDRLYSQVAFLLGTDEVRAERPTVREEVEQGH
YFLHGSIWDTIPAIHRDVQQALRRHYDATAELPAFLQYRSWIGSDRDGNPNVTADVTRWT
VARQRRTTLEHYLDEIDELRDDLSISTRQLTVSDALEASLEADAEEIALPDDVRRQYQRE
PYRLKLCYIEERLRGLLDRIDATDVAAMAGAYAADDLLADLDLIAESLQGHGFEDAAQSG
QLHRLRSLVKTFGFHLAALDVRQHSRVHEDTVAALLDAGDVVDDYGALSEEEKLEVLSRE
LQNPRPLVSRHADLPADAAELMEVFGVLRAMHAVDPDIVGSYVVSMTHTVSDLLEPMLLA
KEAGLGAVVDGSYRCPLDVVPLFETIEDLDAADDRMETLFTHPVYAAQLEGRDGFQEIML
GYSDSNKDGGYWMANWALHKAIHALGVVCDEHDVDLRLFHGRGGTVGRGGGHTSQAIRAL
PPVVHNGRIRMTEQGEIISFRYALPDIARRHVEQIVNATLTATARAQNTPAPENPLLADK
VSMESDVVALMDRLAEEGMSAYREFIDDPEGWQWYTAATPIEHISRLPIASRPVSRASEG
EQVEFENLRAIPWVFAWTQTRYIAPGWYGTGQGLATLLENEPDARDTLRDLYENWPFFRT
VLDSAQREMARARLPIAERYDALAEVETSFHAPIVDDYERAESAILEITDQAALFDGNPV
LKKSIELRNPYTDVLNLIQIELLKRYRASTDDAEQEALREAIFLSINGVAAAMQSTG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctgggacgaccttgacctggagacggagggcaccggcatctccaagcccctg
agccgccaggtcaacctggtgggcagcatgctcgggcacatcgcggaagagcagagtggg
gaagccctcttcgagcacgtcgaggggctgcgcgcgctctgcaaggcggcggagcaggag
gacgcgccggaaaagcgggaggaggccgcggagcggattgcagcgctcgaccaggacacg
ctggagcggctgctgcacgtgtacaccacctttttccacctcgtcaaccaggcggagcag
caggagatcatccgcatcaaccgcgagcgggcccgccagtccggcccgtcggagtggccg
ctggggccgggggacggccccggggccgacggggcggagccgcgcccgcagtcgatcgac
gcggcggtggcggacctgaaggcggagggctacacggccgacgaggtggtggccttcttc
cggcagctcgacattcagcccaccctcacggcccaccccacggaggcgcgccgccgttcg
gtgctgcgcaaggagcagcacatcgccgacctactctcgaccctgcgccgcccggacgcc
acgcccgacgagcgcgccgagacgctggaccgcctctacagccaggtggccttcctcctg
gggaccgatgaggtgcgggccgagcgccccacggtgcgggaggaggtggagcagggccac
tacttcctgcacggatccatctgggacaccattcctgcgatccaccgcgacgtgcagcag
gccctgcgccgccactacgacgccacggccgagctgccggccttcctgcagtaccgctcc
tggatcggcagcgaccgggacggcaaccccaacgtgacggccgacgtcacgcgctggacc
gtcgcccgccagcgccgcaccacgctggagcactacctcgacgagatcgacgagctgcgc
gacgacctgagcatctccacgcgccagctcaccgtctcggacgccctggaggcctccctg
gaggcggacgccgaggagatcgctctgcccgacgacgtgcggcgccagtaccagcgcgag
ccgtaccgtctcaagctctgctacattgaggaacgcctccgcggcctgctcgaccggatc
gacgcgaccgacgtggcggcgatggcgggcgcctacgccgccgacgacctgctcgccgac
ctcgacctcatcgccgaaagcctccaggggcacggcttcgaggacgcggcgcagagcggg
cagctccaccgcctccgctcgctggtcaagacgttcgggttccaccttgccgccctcgac
gtgcgccagcacagcagggtccacgaggacacggtggccgcgttgctggacgcgggcgac
gtggtggacgattacggcgccctgtccgaagaggaaaagctggaggtgctgtcgcgagag
ctccagaacccgcgtccgctggtgagccgccacgcggacctgcccgccgacgcggcggag
ctgatggaggtgttcggggtcctccgggcaatgcacgcggtcgaccccgacatcgtgggc
agctacgtggtgagcatgacccacaccgtgagcgatctgttggagccgatgctgctggcg
aaggaggcggggctcggcgcggtggtcgacggcagctaccggtgcccgctcgacgtggtg
ccgctcttcgagacgatcgaggacctcgacgccgccgacgaccggatggagacgctcttt
acgcacccggtctacgccgcgcagctggaggggcgcgacggcttccaggagatcatgctg
ggctactccgacagcaacaaggacggcggctactggatggccaactgggcgctccacaag
gccattcacgcgctcggggtggtgtgcgacgagcacgacgtggacctgcgtctcttccac
gggcgcggcggcaccgtggggcgcggcggcggccacacctcacaggccattcgggcgctc
ccgccggtcgtccacaacggccgcatccggatgaccgagcagggcgagatcatctccttt
cggtacgccctgcccgacattgcgcggcgccacgtggagcaaatcgtgaacgcgaccctc
acggccacggcccgcgcccagaacaccccggctcccgagaaccccctgctggccgacaag
gtgtcgatggaatccgacgtggtcgcccttatggaccgcctcgccgaggagggcatgtcc
gcctaccgcgaattcatcgacgacccggaggggtggcagtggtacaccgcggccacgccc
atcgaacacatcagccgcctgcccatcgcctcgcggcccgtctcccgggcctcggagggg
gagcaggtcgagttcgagaacctgcgcgccatcccgtgggtgttcgcgtggacgcagacg
cgctacatcgcgccgggctggtacggcaccggccagggcctcgctaccctcctagagaac
gagcccgacgcccgcgacacgctccgggatctgtacgagaactggcccttctttcggacc
gtcctcgacagcgcccagcgcgagatggcccgcgcgcgcctccccatcgccgagcggtac
gacgccctcgccgaggtggagacgtcgtttcacgcccccatcgtggacgactacgagcgg
gcggagtccgccattctcgaaattaccgaccaggcggccctgttcgacggcaatccggtc
ctcaagaagtcgatcgagctccggaacccgtacaccgacgtgctcaatctgattcagatc
gaacttctgaagcggtatcgggccagcacggacgacgccgaacaggaggccctccgcgag
gccatcttcctgagcatcaacggcgtcgccgccgccatgcagagcacggggtag

DBGET integrated database retrieval system