KEGG   Salinibacter ruber DSM 13855: SRU_0890Help
Entry
SRU_0890          CDS       T00312                                 

Gene name
smc
Definition
(RefSeq) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
sru  Salinibacter ruber DSM 13855
Brite
KEGG Orthology (KO) [BR:sru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sru03036]
    SRU_0890 (smc)
Chromosome and associated proteins [BR:sru03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SRU_0890 (smc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_15 AAA_21 AAA_29 ZapB ABC_tran
Motif
Other DBs
NCBI-GeneID: 3852788
NCBI-ProteinID: YP_445024
UniProt: Q2S457
LinkDB All DBs
Position
1139241..1142801
Genome map
AA seq 1186 aa AA seqDB search
MYLSKLELQGFKSFADETTLTFDPGVTTIVGPNGCGKSNIVDAIRWVIGEQRPTVLRSEK
MENLIFNGTADRRPLGMAEVELTIENTDGVLPTEYAEVTIGRRLFRDGTSEYLMNGTTCR
LKDITDLFMDTGMAADAYSVIELKMVDELVSGSTEDRRRMFEEAAGITRYKMRRRQALRK
LDGTQSDLERIRDLTDEVSTQVERLERQAEKAQRYQEAEAELRRLELLLAQVEFNRLTER
QDALQQKETEHAERAAARAEDEEATEARLQELRETLATREATLQERREALQEHRARVREL
EAEQRLQRERLTRARNDRDEAQQAQEEARERRRALTDEVERLESALEQARPALDDAEAAL
DDAREERDAAKAAATDRREDVRERREAAEAAEAEHAEQRRALDQRTNRQELLEDERTRAR
TQYDDLAETIDGLDARIDEAEADRAAAQEALEEARSARAEAATERDERRAALEAAQDELR
ELERRRDAAEAEVELLEGLVGSYDEVSDAVQFLAAEELFDDLYTVADVLGCDDDVRVALD
AALGALASCVVVPTVDDARAAVARLRDAEKGQTSFLVLDRLPDAPPSVSAPEGAVPLRDV
VRTTDPAYAPLADTLLRDCFLVDTLAAAEALAEQTQDAARSVRVFARTGEWVDSTGVLRG
GSRQEDVSPAASRLGRREQLARAREQLGDLQAACEEQDEDVAEAEAALNEIDLAGHESAV
QEAEATLADAEQRLERLRYERTSTEERRAELQERLDEIEEELTEHEDRVHELREAVEAAE
EEMQRRRQERAEAEEALAEAEERERAAVDAFSEAQVAAVEARNRVDNLEQDLERTRDQID
EIDQQTGERTAKIEDLEATIEAALDEQTELDEQIEALREEREDRDESVEAAEAALQETKA
EIEEVESRLRSIRQEREAALEQKNEAAVALTKVETRTQDLLDSMAADFDRDLADDPVSVP
EAFDESEAQSEVKSLRGTINALGDVNPLALEEYEDEKERLDFLREQKTDLEEAEDTLLDT
IQEINTKASERFMETFDEIKESFGTIFTELFGEGASAELQLEDPDDPIDSAIEIVAKPRG
KRPVTLDQLSSGEKALTATALLFSIYLVKPSPFCVLDEVDAPLDDANVERFMNLVRRFED
DTQFVLVTHNQRTMDLSDRMYGVTMEEQGVSTLVGVEFDEAAELTE
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgtacctcagcaaactcgaactgcagggcttcaagagctttgcggatgagaccacgctc
acgttcgaccccggcgtgaccaccatcgtcgggccgaacgggtgcggcaagtcgaacatc
gtcgacgccatccgctgggtcatcggcgagcagcgtcccaccgtgctccggtcggagaag
atggagaacctcatctttaacggcacggccgaccggcgcccgctcggcatggcggaggtg
gagctgacgatcgaaaacaccgacggggtgctgcccacggagtacgccgaagtcacgatc
ggccgccgcctcttccgcgacggcacgtccgagtacttgatgaacgggaccacgtgccgc
ctcaaggacatcacggacctgttcatggacaccgggatggcggcggacgcctactcggtg
atcgagctgaagatggtcgacgaactggtgtccggctccaccgaggaccgccggcgcatg
tttgaggaggcggccggcatcacacgctacaagatgcgccggcgccaggccctccgcaag
ctcgacggcacgcagtcggacctggagcgcatccgcgacctgaccgacgaggtgagcacg
caggtggagcgcctggagcggcaggccgagaaggcgcagcggtaccaggaggcggaggcg
gagctgcggcgcctggaactgctgctcgcgcaggtggagttcaaccggcttacggagcgc
caggacgcgctccagcagaaagagacggagcacgccgagcgggccgcggcgcgggccgag
gacgaggaggcgaccgaggcccgccttcaggagctgcgggagacgctcgcgacccgggag
gccaccctccaggagcgtcgggaggcgctccaggagcaccgggcgcgcgtccgggagttg
gaggcggagcagcggctgcagcgggagcgtctcacccgggcccgcaacgaccgcgacgag
gcgcaacaggcccaggaggaggcccgcgagcggcgtagggccctgaccgacgaggtggag
cgcctggagagcgccctggagcaggcccgtcccgccctcgacgacgccgaggccgccctc
gatgacgcccgcgaggagcgggacgcggcgaaggcggccgcaaccgaccgccgtgaagac
gttcgggagcgccgcgaggccgccgaggcggcggaggccgagcacgccgagcagcgccgg
gcgctcgaccagcgcacgaaccggcaggagcttctggaggacgagcggacgcgtgcccgc
acccagtacgacgacctggcggagaccatcgatgggctcgacgcgcgcatcgacgaggcg
gaggcggaccgcgccgccgcccaggaggcgctcgaggaggcccgctcggcccgggcggag
gccgccacggagcgcgacgagcggcgggccgccctggaagcggcgcaggacgagcttcgg
gagctggaacgccgccgggacgccgccgaggcggaggtcgaactcctcgagggcctcgtc
ggcagctacgacgaggtttcggatgccgtgcagttcctggccgccgaggagctgttcgac
gacctctacaccgtggccgacgtgctcgggtgcgacgacgacgtccgcgtggcgctcgac
gcagccctgggcgccctcgcctcctgcgtggtcgtgcccaccgtcgacgacgcccgggcc
gccgtggcccggctgcgcgacgccgagaagggacagacctcgttcctcgtgctcgaccgc
cttcccgacgcgccgccgtccgtgtcggcgcccgagggcgcggtgcccctccgagacgtc
gtccgcacgacggacccggcgtacgcgcccctggccgacacgctgctgcgtgattgcttc
ctcgtcgacacgctggcggcggcggaggccctcgccgagcagacgcaggacgcggcccgg
tcggtgcgggtgtttgcccgcacgggcgagtgggtcgactcgaccggtgtccttcggggg
gggagccggcaggaggacgtgtcgccggccgcgagtcgcctggggcgccgcgagcagttg
gcccgcgcccgcgagcaactgggcgacctgcaggcggcctgcgaggagcaggacgaagac
gtggcggaggcggaggccgccctcaacgagatcgacctcgcgggccacgagtctgcggta
caggaggccgaggcgaccctcgccgacgccgagcagcgcctggagcggctccgctacgag
cgaacgtcgaccgaggagcggcgcgccgagctgcaagagcgcctcgacgagattgaggag
gagctcaccgagcacgaggaccgcgtccacgagctgcgggaggcggtggaggccgccgag
gaagagatgcagcgccggcgccaggagcgcgccgaggcggaggaggccctcgccgaggcg
gaggaacgcgagcgggcggccgtcgacgccttcagcgaggcgcaggtggcggccgtcgag
gcccggaaccgggtggacaacctggagcaggacctggagcggacccgcgaccagatcgac
gagatcgaccaacagaccggcgagcgcacggccaaaatcgaggacctggaggcgaccatc
gaggcggccctcgacgagcagacggagctggacgaacagatcgaggcccttcgcgaggag
cgcgaggaccgggacgagtccgtggaggcggccgaagcggcgctccaggagacgaaggca
gagatcgaggaagtggagtctcgcctccggtcgatccggcaggagcgcgaggcggccctg
gagcagaaaaacgaggccgccgtggccctgacgaaggtggagacccgcacccaggacctg
ctcgacagcatggcggcggacttcgaccgggacctggcggacgacccggtgtcggtgccc
gaggcgttcgacgagagcgaggcgcagtccgaggtcaagagcctgcgcgggacgatcaac
gccctgggcgacgtgaatcccctcgcgcttgaggagtacgaggacgaaaaggagcgcctc
gactttctgcgggagcagaagacggacctggaggaggcggaggacacgctcctcgacacc
attcaggagatcaacacgaaggcctcggagcgcttcatggagaccttcgacgagatcaag
gagagcttcggcaccatcttcaccgagctgttcggggagggcgcctccgcggagctgcag
ctcgaggacccggacgaccccatcgactcggcgatcgagatcgtggccaagccacggggc
aagcggcccgttacgctcgaccagctgtccagcggcgagaaggccctcacggccaccgcg
ctgctcttctccatctacctcgtgaagccgagccccttctgcgtcctcgacgaggtggac
gcgccgctcgacgacgccaacgtggagcgcttcatgaacctcgtccgtcgcttcgaggac
gacacccagttcgtgctcgtgacccacaaccagcgcacgatggacctctcggaccgcatg
tacggggtgacgatggaggagcagggcgtgtcgacgctcgtgggggtggagttcgacgag
gccgcggagctgaccgagtag

DBGET integrated database retrieval system