KEGG   Salinibacter ruber DSM 13855: SRU_1969Help
Entry
SRU_1969          CDS       T00312                                 

Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00010  Glycolysis / Gluconeogenesis
sru00020  Citrate cycle (TCA cycle)
sru00620  Pyruvate metabolism
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
Module
sru_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_1969
   00020 Citrate cycle (TCA cycle)
    SRU_1969
   00620 Pyruvate metabolism
    SRU_1969
Enzymes [BR:sru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SRU_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF4611 Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 3851983
NCBI-ProteinID: YP_446079
UniProt: Q2S152
LinkDB All DBs
Position
complement(2435007..2436404)
Genome map
AA seq 465 aa AA seqDB search
MAIPIEMPKLSDTMEEGVLSAWLVDEGEEVSAGDVLAQVETDKATMDLEAFDEGVLLKQV
IGEGDAVPIGELIAVIGEAGEDISDLVDDAGGDGAAEPEADPDAEVDSDADAEDASAEPE
VEPEPAPEPSGDGQLSERMPEPVPAGTDAEGRRIKASPLARRIAQEHDVELAQVDGSGPE
GRIVRRDVETHVEKQEAAPESTPEPEPTTEPEPAPQPEPSVPEAPSYAMPDEEAAYESEG
ITQMRETIARRLAESKYSAPHYYLTVDIDVERAIEVREDLNDLAEEQGRAKISFNDFITK
ACALSLHDHPYVNAAYRPDEGEIHKHNRVHIGIAVAIDEGLITPVIRDADRKGLSELARE
TRALAERARDRDLEPEEFEGATFTTSNLGMFGIEEFTAIINPPNSAILAIGEIRDTPVVE
DGEVVPGKRMKVTLSCDHRVVDGAKGAHFLDTVKSYLEEPMNLLL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgattccaattgaaatgcccaagttgagcgacaccatggaggagggggtgctttcc
gcctggctcgtggacgagggcgaggaggtgtcggcgggcgacgtgctggcccaggtggaa
acggacaaggctacgatggacctggaggccttcgacgagggggtgctgctcaaacaagtg
atcggagagggggacgccgtgcccatcggggagctgatcgccgtgattggggaggccggg
gaggacatctccgatctcgtggatgacgccggcggggacggggccgcggagcccgaggcc
gacccggacgccgaggtcgattcggacgccgatgccgaggatgcatcagccgagccggag
gtggagcccgagcccgcgccggagccgagcggggacgggcagttgtccgaacggatgccg
gagccggtgcccgccgggaccgacgcggaggggcgccgcatcaaggcgtctcctctggcc
cgccgcattgcgcaggagcacgacgtggaactggcgcaggtcgacggatccgggcccgag
gggcgcatcgtgcgtcgggacgtggaaacccatgtcgagaagcaggaggccgcgcccgaa
tcgacgcccgaaccggagccgacaaccgaaccggagccggcgccccagcccgagccgtcc
gtcccggaggcgccgtcctacgcgatgccggacgaggaggccgcgtacgagtccgaaggc
atcacgcagatgcgggagaccatcgcccggcgcctcgcggagagcaagtactcggccccg
cactactacctgacggtcgacatcgacgtggagcgcgcgatcgaggtgcgcgaggacctc
aatgatctggcggaggagcagggccgcgcgaaaatctccttcaacgacttcatcaccaag
gcgtgcgccctctcgctgcacgaccacccgtacgtcaacgccgcctaccgccccgacgag
ggcgaaatccacaagcacaaccgcgtgcacatcggcattgccgtcgccatcgacgagggg
ctgatcacccccgtcattcgcgacgcggaccggaaggggctctcggagctcgcccgcgag
acgcgggccttggccgagcgggcccgcgaccgcgacctggagccggaggagtttgaaggg
gcgaccttcaccacgagcaacctcgggatgttcggcatcgaggagttcacggccatcatc
aacccgcccaactcggccatcctggcgatcggcgaaatccgcgacacgcccgtcgtggag
gacggcgaggtggtgccggggaagcgcatgaaggtgaccctctcctgcgaccaccgcgtc
gtggatggggccaagggggcccacttcctcgacacggtgaagtcctacctggaggaaccc
atgaacctgttgctgtag

DBGET integrated database retrieval system