KEGG   Salinibacter ruber DSM 13855: SRU_2437Help
Entry
SRU_2437          CDS       T00312                                 

Gene name
glpA
Definition
(RefSeq) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00564  Glycerophospholipid metabolism
sru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SRU_2437 (glpA)
Enzymes [BR:sru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SRU_2437 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 Pyr_redox_2 3HCDH_N NAD_binding_8 ApbA FAD_oxidored Pyr_redox HI0933_like
Motif
Other DBs
NCBI-GeneID: 3851528
NCBI-ProteinID: YP_446536
UniProt: Q2RZU5
LinkDB All DBs
Position
complement(3044904..3046187)
Genome map
AA seq 427 aa AA seqDB search
MSNFCAHRTLPQFLHGPPPNMNDSPAVLVIGGGATGTGIARDLALRGVEVLLVEREGLSS
GASSRSHGLLHSGARYAEANRVGAEECIAENRVLRSIAGACIRDTGGLFVQLADDDPDYF
EEKRAACDAIGIETTLLSAAEARARVPGLSDDVERAMWVPDGVVYPSRLSAANAADAEAH
GGFVRPHAPLEDLVVERGQVVKALIGGTVDAAVEPTYVVNATGAWAGTVASMADVDLGMA
PSRGVMISVEYEGLGPALNRCRDPDDGDIVVPHDDEVVLGTTSVPVSDPDDYEEADWEVE
TSVRECATMLPPVADAPTVRTWWGVRPLYAPDEQASNRRGISRGFTTVDHAADGVDNFAS
IVGGKLTTYRQMAEAVSDHVCGELGVDAACETATRPLPGADDPDRLDEFVAAYDGQGPTD
ADVSGQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaacttttgtgctcatcggacacttccccaatttctccacggacccccgcccaac
atgaacgactcccccgcagtactcgtgattggcggcggcgccaccggcacgggcatcgcc
cgggacctcgcgctgcgcggcgttgaggtgcttctggtggagcgggaggggctctccagc
ggggcctctagtcgctcccacggactgctacacagcggggcccgttacgccgaggccaac
cgggtgggggcggaggagtgcatcgcagaaaaccgcgtcctccggtccatcgccggggcg
tgcatccgggacaccggcggcctgttcgtccagctggccgacgacgacccggactacttc
gaggagaaacgggcggcctgcgacgcgattgggatcgagacgaccctgcttagcgcggcg
gaagcgcgcgcccgcgtgccgggcctgtcggacgatgtggagcgggcgatgtgggtgccc
gacggggtggtgtacccgtcgcgcctcagtgccgccaatgccgccgatgccgaggcccat
ggcgggttcgtgcgtccccacgcaccccttgaggacctggtggttgagaggggacaggtc
gtgaaggcactgatcggtgggacggtcgacgcggcggtcgagccgacatacgtcgtgaac
gcgacgggggcctgggcgggcacggtcgcgtcgatggccgatgtcgacctgggaatggcc
ccctcccggggcgtcatgatctcggtggagtacgagggcctcggcccggcgctgaaccgg
tgtcgcgacccggacgacggggacatcgtcgtgccccacgacgacgaggtggtgctggga
accacgagcgtgccggtgtcggacccggacgactacgaggaggccgactgggaggtcgag
acgtccgtccgggagtgcgccaccatgctgccccctgtggccgacgccccgacggtccgc
acgtggtggggcgtgcggccgctgtacgcccccgacgagcaggcgagcaatcggcgcggc
atctcgcggggctttaccaccgtggaccatgccgccgacggggtggacaactttgccagc
atcgtcggcggcaagctgacgacctaccgacagatggccgaggccgtgtccgatcacgtc
tgcggcgagctcggcgtggacgccgcgtgcgagacggcgacccggccgctgcccggcgcc
gacgaccccgaccggctcgacgaattcgtcgccgcctacgacggacagggaccgaccgac
gcggacgtgtccggacagggataa

DBGET integrated database retrieval system