KEGG   Salinigranum rubrum: C2R22_01250Help
Entry
C2R22_01250       CDS       T05289                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
srub  Salinigranum rubrum
Pathway
srub00040  Pentose and glucuronate interconversions
srub00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:srub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C2R22_01250
   00053 Ascorbate and aldarate metabolism
    C2R22_01250
Enzymes [BR:srub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     C2R22_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUV80450
UniProt: A0A2I8VEU3
LinkDB All DBs
Position
complement(264064..265509)
Genome map
AA seq 481 aa AA seqDB search
MAHENYIAGEWRPSETGNTTESRNPADTSEVVGEIAESNESDATAAIDAAVEAQEAWAST
PGPERGAILRKTGSLLAERKEEVTETLVREEGKTWSEASGEVQRAIDIFHYYAGKAADMG
GEVKQSSSPDTSLYVRKEPVGAVSVITPWNYPIAIPAWKIAPALATGNTVAFKPATTTGI
TAVRLVECFEDAGLPGGVLNMVTGPGSAVGNTLASDDRVDGVSFTGSATVGDIVYQNAAE
NQTRTLLEMGGKNPTVVCSDADLDESVDIVASGAFGVTGQACTACSRAIVHEDVYDEFVE
RLTDRAASIEVGPGIDDPGMGPQNSEGELSGTLEYIETGVDEGATLETGGGRPDGDGLDD
GYFVEPTVFSDVESDMTIAQEEIFGPVVAVIPVSGFDEAVEVANGVEQGLSASVVTNDLN
KAHRFVDEVDAGVVKTNEKTTGLELHVPFGGMKASSSETYREQGDEGLAFYTISKTVYMN
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgaaaactacatcgcgggcgagtggcgcccatcggagaccggaaacacgaca
gagagtcggaacccggccgacacctcggaggtcgtcggcgagatagctgaatcgaacgag
tcagacgcgacggcggcaatcgacgcggccgtcgaggcacaggaggcgtgggcgtcgacg
cccggcccggaacgcggtgcgatccttcggaagacggggtcgctcctcgcagagcgcaag
gaggaggtaaccgagacgctggtccgcgaggagggcaagacctggtccgaggcttcggga
gaggtacagcgtgcgatcgacatcttccactactacgcggggaaggccgccgacatgggt
ggggaggtcaaacagagcagttcccccgacacgagcctctacgtccggaaggaaccggtg
ggggccgtctcggtaatcactccctggaactaccccatcgccatcccggcgtggaagatc
gcacccgcgctggcgaccgggaacaccgtggcgttcaagcccgcgacgaccacgggcatc
acggcggtccgactggtcgagtgtttcgaggacgcggggctgcccgggggtgtgctcaac
atggtcacgggcccggggtcggccgtcgggaacacgctcgcgagcgacgaccgcgtcgac
ggggtctccttcaccggcagcgccaccgtcggcgacatcgtctatcagaacgccgcggag
aaccagacgcgtaccctcctcgaaatgggcggcaagaacccgacggtcgtctgttcggac
gccgacctcgacgagtccgtcgatatcgtcgcgtcgggcgcgttcggcgtcaccggacag
gcgtgtacggcctgttcccgcgcaatcgtccacgaggacgtgtacgacgagttcgtcgaa
cggctcaccgaccgcgccgccagcatcgaggtcggaccgggtatcgacgaccccgggatg
gggccccagaacagcgagggcgaactgagcggtaccctcgagtacatcgagaccggcgtc
gacgagggagccacgctggagacgggcggcggtcgtcccgacggcgacggactcgacgac
gggtacttcgtcgagccgacggtcttctcggacgtggagtccgacatgaccatcgcacag
gaggagatattcggcccggttgtcgcggtcattcccgtttcggggttcgacgaggcggtc
gaggtggccaacggcgtcgaacagggtctgtcggcgagcgtcgtcacgaacgacctgaac
aaggcccaccgcttcgtcgacgaggtcgacgccggcgtggtcaagacgaacgagaagacg
accggcctcgaactgcacgtccccttcggcgggatgaaagcctcctcctcggagacctac
cgcgagcagggcgacgagggactcgccttctacaccatcagcaagacggtgtacatgaac
tactga

DBGET integrated database retrieval system