KEGG   Salinigranum rubrum: C2R22_02660Help
Entry
C2R22_02660       CDS       T05289                                 

Gene name
rbcL
Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
srub  Salinigranum rubrum
Pathway
srub00630  Glyoxylate and dicarboxylate metabolism
srub01100  Metabolic pathways
srub01120  Microbial metabolism in diverse environments
srub01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C2R22_02660 (rbcL)
Enzymes [BR:srub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     C2R22_02660 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AUV80692
UniProt: A0A2I8VFH6
LinkDB All DBs
Position
complement(546887..548131)
Genome map
AA seq 414 aa AA seqDB search
MTGITYEDFLDLSYEPSDADLVCEFHVEPAADMEIEAAASRVASESSNGTWAELQVEECV
DLSATACDIDGSRVTVAYPDALFEPGNMPQVLSCIAGNIMGMKAVERIRLLDCRWPEGLA
TSFPGPQFGSRVRDEIFDAGDRPILATVPKPKVGLPTKEHVRVGREAWLGGIDLLKDDEN
LTDQSFNPYEDRLTESLAARDEAEEATGESKSYLVNVTGPTHDMLERVDRAAEEGCEYVM
VDVVTTGWGAVQTVRDACESHGVAIHAHRAMHAAFDRIETHGVSMRVIAQLARLCGVDQI
HTGTADLGKLANEDTVGINEWLYSDLYGLRDVLPVASGGLHPGLVPELVSRVGTNVCIQA
GGGIHGHPGGTHDGAKALRQATDATVAGVSLEEYATDYPELAVAMEKWGTETPR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacagggatcacctacgaggacttcctcgacctctcgtacgagccgtcggacgccgac
ctcgtctgtgagttccacgtcgagccggcggccgacatggagatagaggccgccgcctcc
cgagtcgcgtccgagagttcgaacgggacgtgggccgaactccaggtcgaggaatgcgtc
gacctgagcgcgacggcctgcgacatcgacggctcccgggtgaccgtcgcctaccccgac
gcgctgttcgagccggggaacatgccgcaggtgctctcttgcatcgcggggaacatcatg
gggatgaaggcagtcgagcgaatccggttgctcgactgtcggtggcccgaagggctcgcc
acctcgttcccggggccgcagttcgggtcgcgcgtgcgggacgaaatcttcgacgcgggc
gaccggcccatcctcgcgacggtgccgaagccgaaggtcggcctgcccacgaaggaacac
gtccgcgtcggccgcgaggcgtggctgggcggtatcgacctgctgaaggacgacgagaac
ctcaccgaccagtcgttcaacccctacgaagaccgcctgacggagtcgctggcggcgcgc
gacgaggcagaagaagcgacgggcgagtcgaagtcctatctggtcaacgtcacgggaccg
acccacgacatgctcgaacgggtcgacagggcggccgaggagggctgtgagtacgtgatg
gtcgacgtggtgacgacggggtggggcgcggtccagacggttcgggacgcctgcgagagc
cacggggtcgccatccacgcccaccgcgcgatgcacgccgcgttcgaccgaatcgagact
cacggggtgtcgatgcgcgtcatcgcccagctagcacggttgtgcggtgtcgaccagatc
cacaccggtaccgccgacttaggcaaactggcgaacgaggacaccgtcggcatcaacgag
tggctgtactccgacctgtacgggctacgcgacgtgctccccgtggcctccggcgggttg
catccggggctcgtccccgaactcgtctcccgggtggggacgaacgtctgtatccaggcc
ggcggcggcatccacggccaccccggcgggactcacgacggcgcgaaggcgctccggcag
gcgacggacgcgacggtcgccggggtgtcgctcgaagagtatgcgacggactaccctgaa
ctcgccgtcgcgatggagaagtgggggacggagacgccgcgataa

DBGET integrated database retrieval system