KEGG   Salinigranum rubrum: C2R22_03680Help
Entry
C2R22_03680       CDS       T05289                                 

Definition
(GenBank) RNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
srub  Salinigranum rubrum
Brite
KEGG Orthology (KO) [BR:srub00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2R22_03680
Enzymes [BR:srub01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C2R22_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AUV80869
UniProt: A0A2I8VII2
LinkDB All DBs
Position
777873..779009
Genome map
AA seq 378 aa AA seqDB search
MDEREYFQRLESTAETPSDLFEHFETRTHAGWTYHALPSAHHDIERGTVIIPDADVVVRG
YPSVPRVLVLDPGIESVFGEEAVAVEEKLDGFNVRIADLPGEASESLAFTRGGYVCPYTT
GRARDRLDLSAFFADHPEKALCAELVGPETPYTSHDYDDVDSHEFRVFDVRDRASGDPLS
VERRRDLCARYGFEQPRLFGRYEPSDAVEAVRKRIDRLDDAEREGVVLKSTDGTAMVKYT
TESQHHAELAYAFSLPFDYGRDFVFSRVVREAFQAAEFDDSSERLRERAHSLGESILLPM
VETIDDVSAGEAVGERQTVRGPSDEVDALFDHLREQSLTLDVESDRRENGERVVEFLKVS
EATHDRIQYYLGGGTRDE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacgggagtacttccagcggctggagtcgaccgccgagaccccgtccgacctc
ttcgagcacttcgagacgcgcacacacgcgggatggacgtaccacgccctcccctccgct
caccacgacatcgagcgtggaaccgtcattatccccgacgccgacgtcgtcgtccgcggg
tatccgagcgtcccgcgagtcctggttctcgacccgggaatcgagtccgtcttcggcgag
gaggcggtcgccgtcgaggagaaactcgacggcttcaacgttcgaatcgccgacctcccc
ggggaagcgagcgagtcgctcgcgttcacccgtggggggtacgtctgcccgtacacgaca
gggcgggcccgtgaccgactcgatctgtcggcgtttttcgccgaccaccccgagaaggcc
ctctgtgcggaactcgtcggccccgagacgccgtacacgtcccacgactacgacgacgtc
gactcccacgagttccgcgtgttcgacgtccgcgaccgcgcgtccggtgacccgctctcg
gtcgagcgtcgacgcgacctctgtgcgaggtacggcttcgagcaaccacggctgttcggg
cgctacgagccgtctgacgccgtcgaagccgtccgtaagcgcatcgaccgcctcgacgac
gcagagcgggagggcgtggtgctgaagtcgaccgacggcactgcgatggtcaagtacacc
accgagtcgcagcaccacgccgaactcgcctacgccttctcgctcccgttcgactacggc
cgcgacttcgtcttctcgcgggtcgtccgcgaagcgttccaggcggccgagttcgatgac
tcgtccgagcgcctccgcgaacgcgcccactccctcggcgaatcgattctcctgccgatg
gtcgagaccatcgacgacgtctcggcgggggaggcggtcggcgagcgccagacggtccgg
gggccgtccgacgaggtcgacgcgctcttcgaccacctgcgcgagcagtcgctcacgctc
gacgtcgaatccgaccgacgcgagaacggcgagcgcgtcgtcgagttcctcaaggtgtcc
gaggcgacccacgaccgcatccagtactacctcggcggtggaacgcgcgacgagtga

DBGET integrated database retrieval system