KEGG   Salinigranum rubrum: C2R22_16145Help
Entry
C2R22_16145       CDS       T05289                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
srub  Salinigranum rubrum
Pathway
srub00620  Pyruvate metabolism
srub00680  Methane metabolism
srub00720  Carbon fixation pathways in prokaryotes
srub01100  Metabolic pathways
srub01120  Microbial metabolism in diverse environments
srub01200  Carbon metabolism
Module
srub_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:srub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2R22_16145
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    C2R22_16145
   00680 Methane metabolism
    C2R22_16145
Enzymes [BR:srub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C2R22_16145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Peptidase_M16
Motif
Other DBs
NCBI-ProteinID: AUV82986
UniProt: A0A2I8VM35
LinkDB All DBs
Position
3304665..3307355
Genome map
AA seq 896 aa AA seqDB search
MELHTRDVRQDVRELGALLGDVLEDQSSTAAFETVEDLRTSAIAYRAGETESRQSLHDVV
DRLDPDSESAVARAFTTYFELINLAEERERVRANREASQARTLEDSLEETVEALSEADAD
TEDVQAILDDVLIEPTFTAHPTEARRKTVKAKLRSIAQDLEVLDERRMTDKEADQRWKEV
DAEVTSLWQTSQVRDRRPEPQDEARNVQWYLENILFDVVGEVYQEFEDVVHEEYPDVSVP
KLFEFRSWAGSDRDGNPFVTPEVTTDTLERQRDVVIAKYLDALKRLSGVLSQDGRRVDVG
DALRESIEADRERLPVVGEEVEARYPDEPYRQKLKLMRERLRRISDVRPDGYTDPAELLE
DLDDIHESLCATGAEQVAATYVEPLRRQVDTFGFTLASLDLRDHQENHTEAVSEAFAEVG
VDYDAMDEDERVEVLTEAVLQKERLVDLDEPGDVSDTAERVLRRFSKLGDWQREYGVGAI
DTYCISMTEEPSHVLEVLFLADQAGVVSLPDHCGLDIVPLLETESALNGARRIMGTLFEN
EAYEQALAARNDVQEIMLGYSDSNKENGFLAANWDLYKNQRRLASITEDFGVTMRLFHGR
GGSISRGGGPMNRAMLALPNETVTGQIKFTEQGEAIAEKYANPRIAERNLEQMLNAQVRA
RRNAIRQPEEEVPEEWADAMDTMAAAAREEYRALLESEGFVSYFEQATPITVIEDLNLGS
RPASRSGERTVEDLRAIPWVFSWTQSRCILPGWYALASGIEAYLEEGDVETLKEMYDEWP
FFRTTLDRATLSLARTDVEIAAEYADLADSELRESFFPRLSDEYDRAVDHALTICGRDSL
LQREWLEESLSRRNPYVDPLNFLQTHLLAQTHRTPEEEQTLRLTVKGIAAGMKNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcacaccagagacgtcaggcaggacgtccgggagcttggtgcgctcctcggt
gacgttctcgaagaccagtcgtcgacggcggcgttcgagacggtcgaggacctccgaacc
tcggcgattgcctaccgggccggggagacggagtcgcgacagtcgctccacgacgtcgtc
gaccgactcgacccggacagcgagagcgccgtcgcacgcgcgttcaccacctacttcgag
ctgatcaacctcgcagaggagcgcgaacgggtccgcgcgaaccgcgaggcgtcccaggca
cggacgctcgaggacagtctcgaagagacggtcgaagcgctctcggaggccgacgccgac
accgaggacgtccaggcgattctcgacgacgtgctcatcgagccgacgttcaccgctcac
ccgacggaggcgcgccggaagacggtgaaggcgaagctccgttccatcgcgcaggacctc
gaagtcctcgacgaacggcggatgaccgacaaggaggccgaccagcgctggaaggaggtc
gacgccgaggtgacgagcctctggcagacatcgcaggtgcgggaccgccggcccgaaccg
caggacgaggcgcggaacgtccagtggtacctcgagaacatcctcttcgacgtcgtcggc
gaggtgtaccaggagttcgaggacgtcgtccacgaggagtaccccgacgtgagcgtcccg
aaactgttcgagttccggtcgtgggccggctccgacagggacggcaacccgttcgtcacg
ccggaggtgacgaccgacacgctcgaacgccagcgcgacgtcgtcatcgcgaagtatctc
gacgcgctgaagcgcctgtcgggcgtgctcagccaggacggccgacgcgtcgacgtcggc
gacgcgctccgcgagtccatcgaagccgaccgggaacggctaccggtcgtcggcgaggag
gtcgaggcgcgctaccccgacgagccgtaccggcagaagctgaagctgatgcgcgaacgg
ctgcgacgcatctccgacgtccgccccgacggctacaccgaccccgccgaactcctcgaa
gacctcgacgacatccacgagagcctctgtgcgaccggcgccgaacaggtcgccgcgacg
tacgtcgagccgctccgccggcaggtcgacacgttcggcttcaccctcgccagtctggac
ctccgcgaccatcaggagaaccacaccgaggccgtgagcgaggcgttcgcggaggtcggc
gtcgactacgacgcgatggacgaggacgaacgggtcgaggtgctgaccgaggccgtcctc
cagaaggaacgactcgtcgacctcgacgaaccgggcgacgtgtcggacaccgccgagcgc
gtcctccgacgcttttcgaagctcggcgactggcagcgcgagtacggcgtcggcgccatc
gacacgtactgcatctcgatgaccgaggaaccctcacacgtcctcgaagtgctgttcctc
gccgaccaggccggcgtcgtctccctgcccgaccactgcgggctcgacatcgtccccctg
ctggagaccgagagcgcgctcaacggcgcgcggcgcatcatgggcacgctgttcgagaac
gaggcgtacgaacaggccctggccgcgagaaacgacgtccaggagataatgctgggctac
tcggactcgaacaaggagaacggcttcctggccgcgaactgggacctctacaagaaccag
cgtcggttggcctcgatcacggaggacttcggcgtgacgatgcggctgttccacggccgc
ggcggttcgatttcgcggggtggcggcccgatgaaccgcgcgatgctcgcgttgccgaac
gagacggtcaccggccagatcaagtttaccgagcagggcgaggccatcgccgagaagtac
gccaaccctcgaatcgcggagcgcaacctcgaacagatgcttaacgcgcaggtgcgtgcg
cgacgcaacgccatccgccaacccgaggaggaggtgcccgaggagtgggccgacgcgatg
gacacgatggcggccgccgcgcgcgaggagtaccgcgcgctgctcgaatcggaggggttc
gtctcctacttcgagcaggccacgcccatcacggtcatcgaggatctcaacctcggctcc
cgccccgcgtcgcggtccggagagcggacggtcgaagacctccgcgccatcccgtgggtg
ttctcgtggacgcagtcacggtgtatcctccccggctggtacgcgctggcgtccggcatc
gaggcgtacctcgaagagggtgacgtcgagacgctcaaggagatgtacgacgagtggccg
ttcttccggacgacgctcgaccgtgcgaccctctcgctggcgcggacggacgtcgagatc
gccgcggagtacgccgacctcgccgattcggagcttcgggagtcgttcttcccgcgcctc
tccgacgagtacgaccgcgccgtcgaccacgcgctcaccatctgtggacgcgactcgctc
ctccagcgcgagtggctcgaagagagcctctcgcggcggaacccctacgtcgacccgctg
aacttcctccagacgcacctgctggcgcagacgcaccgcacgcccgaggaggaacagact
ctccgactcaccgtgaagggcatcgccgccggcatgaagaacacgggctga

DBGET integrated database retrieval system