KEGG   Streptomyces reticuli: TUE45_00866Help
Entry
TUE45_00866       CDS       T04246                                 

Definition
(GenBank) Putative DNA ligase-like protein/MT0965
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
srw  Streptomyces reticuli
Pathway
srw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:srw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    TUE45_00866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:srw03400]
    TUE45_00866
Enzymes [BR:srw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TUE45_00866
DNA repair and recombination proteins [BR:srw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     TUE45_00866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CUW26155
UniProt: A0A0U5GY57
LinkDB All DBs
Position
I:1067380..1068369
Genome map
AA seq 329 aa AA seqDB search
MTAVTLPLIPPMLATPGTLPPAAQDARWAYETKQDGQRVMVYLPGDGRVLLRARSGEDIT
AAYPELRPLGGALGSTPAVLDGEVLALDERGRADFQLLQSRMGLAHAPARAARRAAQVPV
HLVLFDVPYLVEPLVRLPYTRRRARLEELGLAGPYWSTPAAVTGHGAQALRATREHGLEG
LVCKRLDSVYEPGVRSRAWIKIRNMRAEDVIVGGWLPGKGRLTGLPGAVLAGQRDPDGRL
RYVGGVGTGWSEAERGRLADLLRDAASDRCPFDPVPRVPGARWVLPRLVGEVSYSTRTRN
GMLRQPSWLRLRPDLAPEESAADLPEGYA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgtgaccctgccgctcatcccgccgatgctcgcgacccccggcaccctgccg
ccggccgcgcaggacgcgcggtgggcgtacgagaccaagcaggacggccagcgggtgatg
gtctatctgcccggcgacggacgtgtgctgctgcgcgcccgctccggcgaggacatcacc
gcggcctaccccgaactccggccgctcggcggggcgctgggctccacgcccgccgtgctg
gacggcgaggtgctggccctggacgagcgggggcgggccgacttccagctgctgcagagc
cggatggggctcgcgcacgcccccgcccgggcggcgcgccgggccgcccaggtcccggtg
cacctggtcctgttcgacgtgccgtacctggtggaaccgctggtccggctgccgtacacg
cggcggcgggcgcggctggaggagctgggactcgccgggccgtactggtcgacgccggcc
gccgtgaccggccacggcgcccaggcgctgcgcgccacccgggagcacggcctggagggc
ctggtgtgcaagcggctggactccgtgtacgagccgggggtgcgctcccgcgcctggatc
aagatccggaacatgcgggccgaggacgtgatcgtcggcggctggctgcccggcaagggg
cggctgaccggtctgcccggcgcggtgctggccggccagcgcgacccggacggccggctg
cggtacgtcggcggggtgggcaccggctggagcgaggccgaacgcggccggctggcggac
ctgctgcgggacgcggcgagcgaccggtgccccttcgatcccgtgccccgcgtcccgggc
gcccgctgggtgctgccccggctggtgggtgaggtcagctacagcacccgcacccggaac
ggcatgctccgccagccgtcctggctgcggctgcgccccgatctcgccccggaggagtcg
gcggcggatctgcccgagggctacgcgtga

DBGET integrated database retrieval system