KEGG   Streptomyces reticuli: TUE45_00915Help
Entry
TUE45_00915       CDS       T04246                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase precursor
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
srw  Streptomyces reticuli
Brite
KEGG Orthology (KO) [BR:srw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TUE45_00915
Enzymes [BR:srw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TUE45_00915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Sulphotransf
Motif
Other DBs
NCBI-ProteinID: CUW26204
UniProt: A0A0U5LFD0
LinkDB All DBs
Position
I:1123003..1124154
Genome map
AA seq 383 aa AA seqDB search
MVSATVGRGAVLGAVALSLLAVPARAAAGERDTSAAAALPAPDTAGLAAVLKSAVAQGAP
GALARVDDRGRAHLVTRGVADRATGRALSTDDRFRVGSVTKTFSAVVLLQLVDEHRLVLD
APVNRYLPGLLPDDRITVRHVLGHRSGLYDYTNDMFASSVSGFEAVRTKVFTYRQLVALS
LKKPRTNAPGAAYAYSNTNFVVAGLLIEKLTGQSVRTAYRNRIIEPLKLADTFYVHPDTA
IPGRYARGYLTPDTAGAPLVDATAQTVSWAQSAGAIISSARDLDVFYSALLKGRLMSAAR
LAEMERFTPVNSTTAYGLGLRRRDLSCGVSVYGHTGAVQGYYTYAFGTKDGSRSLTAMAN
TSNNGKVLDTLAGALESAFCGKR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtctcagcaacggtggggcggggagcggtactcggggcggtcgcgctgtcgctgctc
gcggtcccggcgcgggccgcggccggggagcgggacacctcggcggcagcggcgctgccg
gcgcccgacaccgcgggcctggccgcggtgctgaagtcggcggtggcccagggcgcgccg
ggggcgctggcccgggtcgacgaccggggccgggcccacctggtcacccggggcgtcgcc
gaccgcgccaccggacgcgccctcagcaccgacgaccggttccgggtcggcagcgtcacc
aagaccttctcggccgtcgtcctgctccagctcgtcgacgagcaccggctcgtgctcgac
gcaccggtcaaccgctacctgccgggactgctgccggacgaccggatcacggtccgccat
gtgctcggccatcgcagcgggctgtacgactacacgaacgacatgttcgccagcagcgtc
tccggcttcgaggcggtgcggacgaaggtcttcacctaccggcagctggtcgccctctcc
ctgaagaagccgcgcaccaacgcgccgggcgccgcctacgcgtactccaacaccaacttc
gtcgtcgccggactgctcatcgagaagctcaccgggcagtcggtgcggaccgcgtaccgg
aaccgcatcatcgagccgctgaagctcgccgacaccttctacgtccacccggacaccgcg
attccgggccggtacgcccgcgggtacctgacgccggacacggcgggtgccccgctggtc
gacgcgaccgcgcagaccgtgtcctgggcgcagagcgcgggcgcgatcatctccagcgcg
cgggacctcgacgtcttctacagcgcgctgctcaagggcaggctgatgtccgccgcccgg
ctcgcggagatggagcggttcaccccggtgaacagcacgacggcgtacgggctcgggctg
cggcggcgcgacctgtcctgcggggtgtcggtgtacgggcacacgggggcggtgcagggg
tactacacgtacgcgttcggcacgaaggacgggagccggagcctcacggccatggccaac
acgtcgaacaacgggaaggtgctcgacacgctggccggagcgctggagtcggcgttctgc
ggaaagcggtag

DBGET integrated database retrieval system