KEGG   Streptomyces reticuli: TUE45_01076Help
Entry
TUE45_01076       CDS       T04246                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
srw  Streptomyces reticuli
Pathway
srw00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TUE45_01076
Enzymes [BR:srw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TUE45_01076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4159 DUF4350
Motif
Other DBs
NCBI-ProteinID: CUW26364
UniProt: A0A0U5LFT4
LinkDB All DBs
Position
I:complement(1293679..1295700)
Genome map
AA seq 673 aa AA seqDB search
MPDTSPRGLTRLAFGGDYNPEQWPEAVWQEDVRLMREAGVTMVSVGIFSWALLEPAPGEY
DFGWLDRVLGLLHAGGIRVDLGTPTVVPPVWFYRAHPEALPVTAEGVRYEFGSRGAICHS
NADYRAAAANITTRLAERYGDHPALALWHVHNEYGVPVSACYCASCAAHFRRWLADTYGT
VDAVNEAWGTAFWGQRYTDFGQINPPRATPTVGNPGQALDYRRFADATIRENFRAERDIL
HRLSPGVPVTTNFMTALSQCDSMDYWAWGREVDLVTNDHYLITDGRRTHVNLAMAADLTR
SVAGGAPWLLLEHSTSGVNWQPRNPAKAPGQMARNSLAHVARGSEGAMFFQWRQSRRGAE
KFHSAMLPHGGTDTRVWREVVELGACVDALSEIRGTRTEADAAMLWDWQSWWAQNLSWRP
SEDHDPRERADSFYEALYDRHLTVDFAHPEADLSRYPLVVVPALYLMTEAAGNNVREYVE
RGGTLVVSYFSGIVDQHDAVHEGAYPGVLRDVLGLTVEEFSPLLEDERVRLTGPDGSELT
GDVWTEFVVPRGAETVWTYADGLTAGRPAVTRHRHGRGTAWYVSTRLDAQGLDALIGWAA
DDAGLAPRAGLPRDVEVVRRRGESGTYLFVINHTAGDTKVPLDTPGTELLTGERAAGRLA
VPAGAVRVVRLDG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccggacaccagccccaggggcctcaccaggctcgccttcggcggggactacaacccc
gagcagtggccggaagccgtctggcaggaggacgtccgcctgatgcgggaggccggcgtc
acgatggtgagcgtcgggatcttctcctgggccctgctggagccggcgccgggggagtac
gacttcggctggctcgaccgggtcctcggcctcctgcacgcaggcggcatccgtgtcgac
ctcggcacgcccaccgtggtaccgcccgtctggttctaccgggcccaccccgaggcgctg
ccggtcaccgccgagggagtgcgctacgagttcggctcccgcggcgcgatctgccacagc
aacgccgactaccgcgccgccgccgcgaacatcaccacccggctcgccgagcgctacggc
gaccacccggcgctcgcgctgtggcacgtccacaacgagtacggcgtccccgtctcggcc
tgctactgcgcctcctgcgcggcacacttccgccgctggctcgcggacacctacggcacc
gtggacgccgtcaacgaggcctggggcaccgccttctggggccagcgctacaccgacttc
gggcagatcaacccgccccgggccaccccgaccgtcggcaacccggggcaggccctggac
tacagacggttcgccgacgccaccatccgggagaacttccgcgccgagcgggacatcctg
caccgcctctcacccggggtgccggtcaccacgaacttcatgaccgccctcagccagtgc
gactccatggactactgggcctggggccgcgaggtcgacctcgtcaccaacgaccactac
ctgatcaccgacggccgccgcacccacgtcaatctcgccatggccgccgacctcacccgc
tcggtcgccggcggcgccccctggctgctgctggagcactccacctcgggcgtcaactgg
cagccccgcaaccctgccaaggctcccggccagatggcccgcaactccctcgcccacgtg
gcgcgcggctccgagggcgccatgttcttccagtggcgccagtcccggcgtggcgccgag
aagttccactcggcgatgctgccgcacggcggcaccgacacccgcgtctggcgcgaggtg
gtcgaactcggcgcctgcgtggacgcgttgagcgagatccgcggcacccgcaccgaggcc
gacgcggccatgctgtgggactggcagtcctggtgggcgcagaacctctcctggcgcccc
agcgaggaccacgacccgcgcgagcgcgccgactccttctacgaggccctctacgaccgc
cacctcacggtcgacttcgcccacccggaagccgacctgtcacggtatccgctggtcgtc
gtgccggccctgtacctgatgacggaggccgcagggaacaacgtccgggagtacgtcgag
cggggcggcacgctcgtggtgtcgtacttctccggcatcgtggaccagcacgacgccgtc
cacgagggcgcctacccgggtgtgctgcgcgatgtcctcgggctgaccgtggaggagttc
tcgccgctgctggaggacgagcgggtgcggctgaccggcccggacggctccgagctgacg
ggcgacgtgtggacggagttcgtggtcccgcgcggcgccgagaccgtgtggacctacgcc
gacgggctcaccgcgggccgcccggccgtcacccggcaccggcacggccggggcaccgcc
tggtacgtctccacccgcctcgacgcccagggcctggacgcgctcatcggctgggcggcc
gacgacgccggcctcgccccgcgcgccggcctgccgcgtgatgtcgaggtcgtgcgccgc
cgcggcgagtccggcacctacctcttcgtcatcaaccacaccgccggcgacaccaaggtg
ccgctggacacgcccggcaccgagctgctgacgggcgaacgcgccgcgggccgcctcgcg
gtcccggcgggggccgtccgggtcgtacgactcgacggctga

DBGET integrated database retrieval system