KEGG   Streptomyces reticuli: TUE45_01286Help
Entry
TUE45_01286       CDS       T04246                                 

Definition
(GenBank) Putative polyketide cyclase
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
srw  Streptomyces reticuli
Pathway
srw01056  Biosynthesis of type II polyketide backbone
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
Module
srw_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    TUE45_01286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:srw01004]
    TUE45_01286
   01008 Polyketide biosynthesis proteins [BR:srw01008]
    TUE45_01286
Enzymes [BR:srw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     TUE45_01286
Lipid biosynthesis proteins [BR:srw01004]
 Polyketide synthase
  Component type
   TUE45_01286
Polyketide biosynthesis proteins [BR:srw01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     TUE45_01286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Motif
Other DBs
NCBI-ProteinID: CUW26574
LinkDB All DBs
Position
I:complement(1602799..1603764)
Genome map
AA seq 321 aa AA seqDB search
MARDAEPGTIDGTTEVTHRIEVAAPAKAVYRIVAEVGLWPLYFPPTVRAERTGGDGTEER
IRIWALANGDLRTWESRRRLDPVTFRIEFEQIQPREPVAAMGGTWRITERGDGGCTVELD
HFYRAVDGDPVAHERITRAVDTNSRSELEHLKRAAERGDAEQELLFDFADTETITGSIEE
AYAFIYEASRWPERLPHVARIELREEETGLQFMEMDTRSPDGSLHTTASGRVCEPLRRIT
YKQTTLPPVLQAHNGEWRFEEGPEGIVRITSHHQVLLDPAGIEALPHPPATLADARQAVR
HALGSNSRATMARAREFAQDR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgacgccgaacccggcaccatcgacggcaccaccgaagtgacccaccgcatc
gaggtggcggccccggcgaaggcggtctaccggatcgtcgccgaagtgggcctgtggccg
ctgtacttcccgcccaccgtgcgggccgaacggaccggcggcgacgggaccgaggagcgg
atccggatctgggcgctggccaacggcgacctgcgcacctgggagtcgcggcgccggctg
gacccggtcacgttccgcatcgagttcgaacagatccagccgcgcgagccggtcgcggcc
atgggcggcacctggcggatcaccgagcgcggcgacggcggctgcacggtggagctggac
cacttctaccgggcggtcgacggcgacccggtggcccacgagcgcatcacccgggccgtc
gacaccaacagccgctcggagctggagcacctcaagcgggcggccgagcggggagacgcg
gagcaggagctgctgttcgacttcgccgacaccgagaccatcaccggctcgatcgaggag
gcgtacgccttcatctacgaggcgtcccggtggccggagcgcctcccgcacgtggcacgg
atcgaactccgcgaggaggagaccgggctgcagttcatggagatggacacccgctccccg
gacggctcgctgcacaccacggcgtccggccgggtctgcgagccgctgcggcggatcacc
tacaagcagaccactctgccgccggtgctccaggcgcacaacggggagtggcggttcgag
gagggcccggagggcatcgtgaggatcacctcgcaccatcaggtcctcctcgacccggcc
ggcatcgaggccctgccccacccgcccgcgacgctggccgacgcccggcaggcggtgcgg
cacgccctgggctcgaacagccgggccaccatggccagggcccgcgagttcgcccaggac
cggtga

DBGET integrated database retrieval system