KEGG   Streptomyces reticuli: TUE45_02392Help
Entry
TUE45_02392       CDS       T04246                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox Methyltransf_25 TrkA_N PglD_N 3HCDH_N ThiF
Motif
Other DBs
NCBI-ProteinID: CUW27665
UniProt: A0A0U5LF36
LinkDB All DBs
Position
I:2813393..2814382
Genome map
AA seq 329 aa AA seqDB search
MKAAVIESVGRAVVTEVPDPTPGPREVVVEVAACGLCGTDLHILQGEFAPKLPIVPGHEF
AGEVVGVGTQVTEVAVGDRVAVDPSLYCYECRYCRTGHNNLCERWAAIGVTTAGGAARYA
LAPVANCVKLPEHVRTEDAALVEPLSCAVRGYDVLRSRLGAHVLIYGSGTMGLMMLELAK
RTGAARVDVVDVNPARLETARLLGVSAAAAHADELDRPQGWDVVVDATGNAAAIQDGLGR
VAKAGTFLQFGVADYATRVTIDPYRIYNQEITITGSMAVLHSFERAAELFANGVLDPAVF
ISDRIPLERYPQALEQFAAGVGRKIVVVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtcatcgagtccgtgggccgcgccgtcgtcaccgaggtcccggacccg
acgccgggcccccgcgaggtcgtcgtcgaagtggcggcctgcggcctgtgcggcacggac
ctgcacatcctccagggcgagttcgcgcccaagctgccgatcgtccccgggcacgagttc
gcgggcgaggtcgtcggggtcggcacccaggtcaccgaggtggccgtcggcgaccgggtg
gccgtggacccctcgctgtactgctacgagtgccggtactgccgtaccggccacaacaac
ctgtgcgagcggtgggccgcgatcggcgtgacgacggcgggcggcgcggcgcggtacgcg
ctcgccccggtcgccaactgcgtgaagctgcccgagcacgtgcgcaccgaggacgcggcc
ctggtggagcccctgtcctgcgcggtgcgcggctacgacgtcctgcgctcccggctcggc
gcccacgtcctgatctacggctccgggacgatgggcctgatgatgctggagctggccaag
cggaccggtgcggcccgcgtggacgtggtcgacgtgaacccggcccgcctggagacggcc
cggctgctcggcgtctcggccgccgcggcgcacgcggacgaactggaccgcccgcagggc
tgggacgtggtggtggacgccaccggcaacgcggcggcgatccaggacggcctgggccgg
gtggccaaggcgggcacgttcctccagttcggggtggccgactacgcgacccgggtgacg
atcgatccgtaccggatctacaaccaggagatcaccatcaccggctccatggcggtcctg
cacagcttcgagcgggcggcggagctgttcgcgaacggggtgctggacccggccgtcttc
atcagcgaccggatcccgctggagcggtacccgcaggcgctggagcagttcgcggccggc
gtgggccggaagatcgtggtggtgccgtag

DBGET integrated database retrieval system