KEGG   Streptomyces reticuli: TUE45_02909Help
Entry
TUE45_02909       CDS       T04246                                 

Gene name
geoB_1
Definition
(GenBank) Geranial dehydrogenase
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CUW28179
UniProt: A0A0U5M5F5
LinkDB All DBs
Position
I:complement(3376414..3377865)
Genome map
AA seq 483 aa AA seqDB search
MAGLVEHGQLFIGGELADPLGQGVIEVVSPHTEEVIGRVPHASRADVDRAVAVARRAFEE
GAWPRTPLDERIEVVSRIKDGIAARHEEIARVISSENGSPYSWSVLAQALGAMMVWDAAI
RVAREFTYEERRDGVLGPILVRREPVGVVAAVVPWNVPQFVAAAKLAPALLTGCTVVLKP
SPESPLDAYLLGEIAREAGLPEGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGRRVM
EVAARNLARVTLELGGKSAALVLPDADLQAAVAGIVPAAWMNNGQACVAQTRILLPRSRY
DEFADAFAAAASALRVGDPLDPATQVGPLVARRQQERTLDFIRIGQEEGAKILTGGGRPD
GLDRGWYVEPTLFGDVDNAMRIAREEIFGPVVCLIPYGDEAEAVRIADDSDYGLSGSVWT
ADVEHGVDIARRIRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEYLEHKTIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcttgtggagcacggacagctgttcatcggcggggagttggccgatccgctg
ggtcagggtgtgatcgaggtggtctcgccgcacaccgaggaggtcatcgggcgggtgccg
cacgcctcgcgggcggatgtcgaccgggccgtggccgtcgcgcgccgtgccttcgaggag
ggggcctggccccggaccccgctggacgagcggatcgaggtcgtctcccgcatcaaggac
ggcatcgccgcccggcacgaggagatcgcccgggtgatctcgtcggagaacggctccccg
tactcctggagcgtcctcgcccaggcgctcggcgcgatgatggtgtgggacgcggcgatc
cgggtcgcgcgcgagttcacgtacgaggagcgcagggacggcgtgctggggccgatcctg
gtccggcgggagccggtgggcgtggtcgccgcggtcgtaccgtggaacgtcccgcagttc
gtcgccgccgccaagctggcgcccgcgctgctgaccggctgcacggtcgtcctcaagccg
tccccggagtccccgctggacgcctacctgctcggcgagatcgcccgcgaggccggcctg
cccgagggtgtgctgtccatcctccccgccgatcgcgaggtcagcgagtacctggtcggc
caccccggcgtcgacaaggtctccttcaccggctcggtcgcggccggcaggcgcgtgatg
gaggtcgccgcccgcaacctcgcccgggtcaccctggaactcggcggcaagtcggcggcg
ctggtgctgccggacgcggacctccaggcggcggtcgcgggcatcgtcccggcggcctgg
atgaacaacgggcaggcgtgtgtcgcccagacccgcatcctgctgccgcgctcccgctac
gacgagttcgcggacgccttcgcggcggcggcgagcgccctgagggtcggcgacccgctg
gaccccgccacccaggtcggcccgctcgtcgcccggcgccagcaggaacgcaccctggac
ttcatccgcatcggccaggaggagggcgccaagatcctcaccggcggcggccgccccgac
gggctggaccgcggctggtacgtcgaacccaccctcttcggcgacgtcgacaacgccatg
cgcatcgcccgcgaggagatcttcggccccgtcgtctgcctgatcccgtacggcgacgag
gccgaggccgtgcggatcgccgacgactccgactacggcctctccggcagcgtgtggacg
gcggacgtcgagcacggcgtcgacatcgcccggcggatccgcaccggcacctactccgtc
aacaccttcagcctggacatgctcggcccgttcggcggctacaagaactccgggctgggg
cgggagttcgggccggaggggtacggggagtacctggagcacaagacgatccacctgccg
gcgggggcgtag

DBGET integrated database retrieval system