KEGG   Streptomyces reticuli: TUE45_03720Help
Entry
TUE45_03720       CDS       T04246                                 

Definition
(GenBank) sensory histidine kinase AtoS
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS PAS_9 PAS_4 PAS_8 Response_reg PAS_7
Motif
Other DBs
NCBI-ProteinID: CUW28985
UniProt: A0A0U5LQ61
LinkDB All DBs
Position
I:4297194..4302299
Genome map
AA seq 1701 aa AA seqDB search
MSSRPSRGAARLAAILDALPDALVLVNANGTVVNANTIALEAFEAPGTALVGRGLLDLLP
QFDSRLIPGSMRRPDHMDPTGRTKPTRMVARRTDGSEFPVEVTSANLENGQQAYDGYGYT
GDELLMIVVRDLSGTVDTEAELARSQRQTEMILRAAAEGVVGTDTDGRIVLVNPAAAQIL
GYRAGELGGKELHTLVLHSRADGSPFPYEESPLADTLRSGRKHRVRGQVLWSKGDKKVPV
DLTTAPVRDGDQLVGAVMTFTDRRPFDALVEEKAALEKAHAEELERLSEEHASDLTALRQ
QHVTEVEELREKHAEELAAGEERYAALAEREKDRYEALAGRHEQLLTLLGQSLRGPLDEL
RRELSALAADDAGQLWPEANQVLHHLSAGYSRITTLIDNVLGYQRLDAGSEDITRTKVML
DAVVAAGVDGAVELIGPGRVQFAVHAPPIEAEVDPQRLATALAHLVADVAGVDATGNTPV
SAGGYLDSTVVVAAAQRGEVARIEVRGPYAGGDPVHEPIVRGIVRAHGGVLQTHEVPGMS
GSAYVLEVPLGGGAGAVAAADTEAPVAAPVPDGGGSAAEDSGAAEQTVGGGRRRGRRAST
DAFLESDVAGPGDAGEAEAPAPTGRRRRRAAAPAEEAAAVPAEGAETASGGTGRRRGRPA
ETGNADSAGAGEAQGVAEGAVVTAAEQGAGAAASGTGLGGTVPPQGVPVPTGRRARRGSD
APQAALPPALPAAGGHQPMPGAQALPGAPVAPGAQAVPAEGGPVVPAQGGEAAAEGAQPG
GRRRRALAAAAERAAAQEASGTRTVFALPPAEADRSPQAPDAANGTAAAVGAAVPVAPGA
SAPVAPDAGVPMAPDAGVPMAPGAGVPVAPGAPAVPGAGPAAPGAAAGADGRPQGGGPLP
GALPLPGQVQVPAQMPLSVEGVPGDDGRHDAVPLDQADDHTPPQPHPTSAPTGRRRRAVA
RPAEAAQAVTPGTVPGQAPPPSLPDPLPTPAAPGQAPQATAAAPVPGQAAHGVPAQGTAG
QGIPVQAGAVQTGQVQAGPVPSAGQPSGAAQPAVPADPATQPGAPGRPATTAPPTVPAQG
TPPQVTPPQATPAHGTPGPAPAPMAPAQGTPPRTTPAQGTPAQPAPPAAPAPQPSAVPGP
GTAAQPAPAPAPQQPAPAQPGTPPAGTPVAAPGALPLPAEAGQVPAAGPQGAQAVPVPPG
GASAAGVPQQWPNAGDPAGTGTQTPAPGTPAPGTPAPATPAHGTPAPGTPAPGTPLPAGA
PGPVGNAGPAAGQPQRAAQPLPAEAAGGVPVDPDSTQGRAISVRTLGQGVPFARQAAQVQ
QPTATPPPHAPGGSGRRRKLGTPPDPATRPEPRPDQAARPHPPAEPAPGQPSVTGQPSVP
GQPPLAGQPSVPQPAPAGPVPVPQPSLGGQSRSVAGTEGAGRSYAIGAPEPDAAEGPEPL
DGPGGAVEVADTPRPQPLDDELPPEPLDNPRRLLVWPAPDVTTQQALSDRGYRPVVVHSR
EEVDAQIAAFPAALFVDPLTGPITRTALQSLRQAAVAAEVPVLVTAGLGQATREAAYGAD
PAVLLKALAPRDSEQHPPRVLLIEEHAEIALALTSTLERRGMQVARAASDNDAVTLAGQF
RPNLVVMDLMQVHRRRAGIVDWLRANGQLNRTPLVVYTAAVDQADLPRLASGETVLFLAE
RSTSTEVQSRIVDLLARIGTN
NT seq 5106 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcaggccatcccgaggcgctgctcgcctcgcagccatactcgacgcgctgccg
gacgcgttggtcctggtcaacgccaacggaaccgtcgtcaacgccaacaccatcgcgctg
gaggccttcgaggcgcccggcacggctctggtggggcgcgggctgctcgatctgctgccg
cagttcgactcccggctcatccccggctcgatgcgacggcccgaccacatggatcccacg
gggcggaccaagccgacccggatggtcgcccggcggaccgacgggagcgagttccccgtc
gaggtcaccagcgcgaacctggagaacgggcagcaggcgtacgacggttacggctacacc
ggcgacgagctgctcatgatcgtggtccgggacctgtccgggactgtcgacaccgaggcg
gagctggcccgctcgcagcggcagaccgagatgatcctgcgggcggccgcggaaggtgtc
gtgggcaccgacaccgacgggcggatcgtgctcgtcaatccggccgccgcccagatactg
gggtaccgggccggtgagctgggcggcaaggagctgcacacgctggtgctgcactcccgc
gccgacggctcgcccttcccgtacgaggagtcgccgctcgccgacaccctgcgctcgggg
cgcaagcaccgggtgcgcgggcaggtgctgtggtccaagggcgacaagaaggtgccggtc
gatctgaccaccgcgccggtgcgggacggggaccagctcgtcggcgccgtgatgaccttc
accgaccggcggccgttcgacgccctggtggaggagaaggccgcgctggagaaggcgcac
gccgaggagctggaacggctctccgaggagcacgcctccgacctgaccgcgctgcgccag
cagcatgtcaccgaggtcgaggagctgcgcgagaagcacgcggaggagctggcggccggc
gaggagcggtacgccgcgctcgccgagcgggagaaggaccggtacgaggccctcgccggg
cggcacgagcagctcctcacgctgctcggacagtcgctgcgcgggccgctggacgagctg
cggcgcgagctgtccgcgctcgccgccgacgacgccggccagctgtggcccgaggccaat
caggtgctgcaccacctgtccgccggctactcgcggatcaccaccctcatcgacaacgtg
ctcgggtaccagcggctggacgcgggcagcgaggacatcacccgtacgaaggtgatgctg
gacgccgtcgtcgccgccggggtggacggggccgtcgagctgatcgggccgggacgcgtg
cagttcgccgtccacgcgccgcccatcgaggccgaggtcgacccgcagcggctcgccacc
gcgctcgcgcacctggtggcggacgtcgccggggtcgacgcgaccggcaacacgcccgtc
tcggcgggcggttacctggacagcaccgtcgtcgtggccgccgcgcagcgcggcgaggtc
gcgcgcatcgaggtgcgcgggccgtacgccggcggggacccggtgcacgagccgatcgtg
cgcgggatcgtgcgcgcccacggcggtgtgctgcagacgcacgaggtgccgggcatgagc
ggcagcgcctacgtcctggaggtgccgctcggcggcggggcgggcgcggtcgccgcggcg
gacaccgaggccccggtcgcggcaccggttccggacggcggcgggagcgccgcggaggac
tccggcgcggccgagcagacggtcggcggcggccggcggcggggccggcgggcctccacg
gacgccttcctggagagtgacgtggccggcccgggtgacgccggcgaggcggaggcgccc
gcgccgaccggacggcgccggcggcgggccgccgcgcccgccgaggaggccgccgcggta
cccgccgagggcgcggagaccgcgtccggcgggaccgggcgacgccgtggacggcccgcc
gagaccggcaacgccgacagcgccggtgctggcgaggcccagggtgtggccgagggggcc
gtggtgaccgcggccgagcagggggcgggggccgccgcctcgggcacggggctcggtggc
accgtgccgccgcagggcgtgcccgtgcccacgggccggcgtgcccgccgcggctccgac
gccccgcaggccgccctgccgccggcccttccggcggccggcggccaccagccgatgccg
ggcgcgcaggccctgccgggcgcgcccgtggctccgggcgcgcaggccgtaccggccgag
ggtgggccggtggttccggcgcagggcggcgaggcggcggccgagggcgcgcagccgggc
gggcggcgccgtcgggcgctggccgcggcggccgagcgggccgcggcgcaggaggcgagc
ggcacgcggacggtcttcgccctgccgccggccgaggccgaccggtccccgcaggccccg
gacgccgcgaacggcaccgccgccgccgtgggtgcggccgtgccggtggcgccgggtgcg
agtgcgccggtggcgccggacgccggtgttccgatggcgccggacgccggtgttccgatg
gctccgggcgccggtgttccggtggcgccgggcgccccggccgtgcccggcgcgggtccc
gccgctcccggcgcggctgccggtgccgacggccggccccagggcggcggaccgctgccc
ggtgccctgccgttgcccggtcaggtgcaggtgcccgcgcagatgccgctctcggtcgag
ggcgtcccgggtgacgacggccggcacgacgccgtaccgctcgaccaggccgacgaccac
accccgccgcaaccgcatccgaccagtgccccgaccggccgccggcgccgggccgtggcc
cggcccgccgaggcggcccaggcggtcacgccggggaccgtgcccggacaggccccgccc
ccgtcgcttccggatcccctgccgacgcccgccgctcccggacaggccccgcaggccacg
gccgcggcgccggttcccggccaggccgcgcacggcgttccggcgcagggtacggccggg
cagggcatccccgtccaggccggtgccgtccagaccggtcaggtccaggcaggtcccgtg
ccgtcggcggggcagccgtccggcgctgcccagccggccgttccggccgaccccgccacc
cagccgggtgccccgggccggccggccacgacggccccgcccaccgttcccgcccagggc
acgccgccccaggtcacgccaccccaggccacgcccgcccacggcacgcccggccccgcg
cccgccccgatggcacccgcccagggcacgcctccccggaccacgcccgcccagggcacc
ccggcgcagcccgcgccccccgccgcgccggccccgcagccgtcggccgtacccgggccg
ggcaccgccgcgcagcccgctcccgccccggcaccgcagcagccggcccccgcgcagccg
ggcacgccgcccgccggtactccggtggcggctccgggtgcgctgccgttgccggccgag
gccgggcaggtgcccgccgccgggccgcagggtgcccaggccgtgccggtgccgcccggc
ggcgcctcggcggccggcgtcccgcagcagtggccgaacgccggtgaccccgccggcacg
gggactcagacccccgcacccggcacccccgcacccggcaccccggctcccgcgactccg
gcccacggcacccccgcgcccggcactcccgcccccggcaccccgcttcccgccggggcc
ccggggccggtcgggaacgccgggcccgccgccggtcagccgcagcgggccgcgcagccc
ttgcccgcggaggccgcgggcggagtgccggtcgacccggactcgacgcagggccgggcg
atcagcgtgcgcacgctcgggcagggcgtgccgttcgcccggcaggccgcgcaggtgcag
cagccgacggcgactccgccgccgcacgcgccgggcggttcgggccggcggcgcaagctg
ggcacgccccccgacccggccacccgaccggagccgcggccggaccaggcggcccggccg
cacccgccggccgaaccggcgcccggacagccgtcggtcactgggcagccgtccgtcccc
ggccagcccccgctcgccgggcagccgtcggtgccgcagcccgcgccggccggtccggtg
cccgtgccgcagccctcgctcggcgggcagtcccggtcggtcgcgggcaccgagggggcc
gggcggtcgtacgccataggcgccccggagcccgacgccgccgaggggccggagccgctg
gacgggcccggcggggccgtggaggtggcggacacgccgcgtccgcagccgctggacgac
gagctgccccccgagccgctggacaacccgcgccggctgctggtgtggcccgcgccggac
gtgacgacccagcaggcgctgagcgaccgtggctaccgcccggtcgtcgtgcactcgcgc
gaggaggtcgacgcgcagatcgcggccttccccgccgcgctcttcgtggacccgctgacc
gggcccatcacgcgcacggcgctgcagtcgctgcgccaggccgcggtggccgccgaggtc
ccggtgctggtcacggccggactgggacaggcgacgcgcgaggcggcgtacggcgccgat
cccgccgttctgctgaaggcgctggctccccgggacagcgagcagcatccgccgcgggtg
ctgctcatcgaggagcacgcggagatcgcgctggcgctgacctcgacgctggagcggcgc
gggatgcaggtggcacgggccgcgagcgacaacgacgcggtgacgctggcggggcagttc
cggccgaacctcgtggtgatggacctgatgcaggtgcaccgccggcgggccgggatcgtg
gactggctgcgggcgaacgggcagctcaaccgcaccccgctggtcgtctacacggccgcc
gtcgaccaggccgacctgccccggctggcctcgggcgagacggtgctgttcctcgccgag
cggtcgacgagcaccgaggtgcagagcaggatcgtggatctgctggcccggatcggcacc
aactag

DBGET integrated database retrieval system