KEGG   Streptomyces reticuli: TUE45_04894Help
Entry
TUE45_04894       CDS       T04246                                 

Gene name
yfmT
Definition
(GenBank) Putative aldehyde dehydrogenase YfmT
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
srw  Streptomyces reticuli
Pathway
srw00010  Glycolysis / Gluconeogenesis
srw00053  Ascorbate and aldarate metabolism
srw00071  Fatty acid degradation
srw00280  Valine, leucine and isoleucine degradation
srw00310  Lysine degradation
srw00330  Arginine and proline metabolism
srw00340  Histidine metabolism
srw00380  Tryptophan metabolism
srw00410  beta-Alanine metabolism
srw00561  Glycerolipid metabolism
srw00620  Pyruvate metabolism
srw00625  Chloroalkane and chloroalkene degradation
srw00903  Limonene and pinene degradation
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
srw01120  Microbial metabolism in diverse environments
srw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUE45_04894 (yfmT)
   00053 Ascorbate and aldarate metabolism
    TUE45_04894 (yfmT)
   00620 Pyruvate metabolism
    TUE45_04894 (yfmT)
  Lipid metabolism
   00071 Fatty acid degradation
    TUE45_04894 (yfmT)
   00561 Glycerolipid metabolism
    TUE45_04894 (yfmT)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TUE45_04894 (yfmT)
   00310 Lysine degradation
    TUE45_04894 (yfmT)
   00330 Arginine and proline metabolism
    TUE45_04894 (yfmT)
   00340 Histidine metabolism
    TUE45_04894 (yfmT)
   00380 Tryptophan metabolism
    TUE45_04894 (yfmT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TUE45_04894 (yfmT)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TUE45_04894 (yfmT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TUE45_04894 (yfmT)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TUE45_04894 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: CUW30174
UniProt: A0A0U5LLS8
LinkDB All DBs
Position
I:5522696..5524156
Genome map
AA seq 486 aa AA seqDB search
MSSCFTDLAQQYIDGEWRPGTGSWDVIDFNPYDDEKLASITVATVDEVDQAYQAAARAQK
KWAETNPYTRRAVFERALRLIEDREQEIADLIIAELGGTRVKAGFELHLAKEFLRESIHL
ALRPEGKILPSPTEGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPH
QNTPIAGGTLLAKIFEEAGLPGGLLNVVVTDIAEIGDAFLEHPVPKVISFTGSDKVGRHV
ATVCARHFKRSVLELGGNSALVVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDASV
ADEFTEKFVAKVRSLKVGDPRDPETVIGPVINSAQANAISGIVEQALAEGATALVRGSTT
NNLVEPTVLTGVPADSALLRQEVFGPVVFLVPFDGEEEAVRIVNDTPYGLSGAVHTGDIE
RGVAFAKRIDTGMFHVNDGTVHDEPIVPFGGEKHSGLGRLNGETTLEAFTTVKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctgcttcaccgacctggcccagcagtacatcgacggcgaatggcgcccgggc
acgggctcctgggacgtcatcgatttcaacccctacgacgacgagaagctggcctcgatc
acggtggccacggtcgacgaggtggaccaggcctaccaggccgccgcccgcgcccagaag
aagtgggccgagaccaacccctacacccggcgagcggtcttcgagcgggccctgcggctg
atagaggaccgcgagcaggagatagccgacctgatcatcgcggagctgggcggcactcgc
gtgaaggcaggcttcgagctgcacctcgccaaggagttcctgcgcgagtcgatccacctc
gcgctgcgccccgagggcaagatcctgccctccccgacggagggcaaggagaaccgggtc
taccgggtcccggtgggcgtggtgggcgtgatcagcccgttcaacttccccttcctgctc
tcgctgaagtcggtcgcgcccgccctggcgctcggcaacgccgtggtgctcaagccgcac
cagaacaccccgatcgccggcggcaccctgctcgccaagatcttcgaggaggccgggctg
cccggcggcctgctcaacgtcgtcgtcaccgacatcgccgagatcggtgacgcgttcctc
gagcaccccgtcccgaaggtcatctccttcaccggctccgacaaggtcggccggcacgtc
gccaccgtctgcgccaggcacttcaagcgctcggtcctcgaactgggcggcaacagcgcg
ctggtggtgctggacgacgccgacctcgactacgcggtggacgcggcggtcttcagccgg
ttcgtgcaccagggccaggtctgcatggccgccaaccgggtcctcgtggacgcgtccgtc
gccgacgagttcaccgagaagttcgtcgccaaggtcaggtccctcaaggtcggcgacccg
cgcgacccggagaccgtcatcggcccggtgatcaactccgcgcaggcgaacgcgatctcg
ggcattgtcgagcaggcgctcgccgagggcgccaccgccctggtgcgcggcagcacgacc
aacaacctggtcgagccgaccgtgctgaccggcgtaccggccgactccgcgctgctgcgg
caggaggtcttcggcccggtggtcttcctcgtcccgttcgacggcgaggaggaggcggtc
cggatcgtcaacgacaccccgtacggcctcagcggcgccgtgcacaccggtgacatcgag
cggggcgtggccttcgccaagcggatcgacaccggcatgttccacgtgaacgacggcacc
gtccacgacgagccgatcgtgcccttcggcggcgagaagcactccggcctcggccgcctc
aacggcgagaccacgctggaggcgttcacgaccgtgaagtggatctcggtgcagcacggc
cgcagcggattccccttctag

DBGET integrated database retrieval system