KEGG   Streptomyces reticuli: TUE45_04897Help
Entry
TUE45_04897       CDS       T04246                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
srw  Streptomyces reticuli
Pathway
srw00250  Alanine, aspartate and glutamate metabolism
srw00410  beta-Alanine metabolism
srw00430  Taurine and hypotaurine metabolism
srw00650  Butanoate metabolism
srw01100  Metabolic pathways
srw01110  Biosynthesis of secondary metabolites
srw01120  Microbial metabolism in diverse environments
srw02024  Quorum sensing
Module
srw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TUE45_04897 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TUE45_04897 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TUE45_04897 (gadB)
   00430 Taurine and hypotaurine metabolism
    TUE45_04897 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TUE45_04897 (gadB)
Enzymes [BR:srw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TUE45_04897 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CUW30177
UniProt: A0A0U5MB44
LinkDB All DBs
Position
I:complement(5525536..5526942)
Genome map
AA seq 468 aa AA seqDB search
MALHRGPERHEARTVSVNPFFGAADPVGGMAEAPPTHRLPDAPLPPATAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
SAAVGCSTTGSSEACMLAGMALKRRWARRNADRYPGARPNLVMGINVQVCWEKFCAFWEV
EARQVPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVAELCAALDALQERTG
LDIPVHVDGASGGMVAPFLDEDLVWDFRLPRVASINCSGHKYGLVYPGVGWALWRDREAL
PEELVFRVNYLGGEMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQRTTRDVACSLAG
RIAALGDFRLLTRGDQLPVFALTTADGITSYDVFDVSRRLREGGWLVPAYTFPAHREDLS
VLRIVCRNGFSHDLADLFLDDLTRLLPELRRQPHPLTRDKGAATGFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcaccgaggtcccgagcggcacgaggcgcggacggtgtcggtcaaccccttc
ttcggggcggccgacccggtcggcggcatggccgaggcgccgcccacgcaccggctcccg
gacgccccgctgcccccggccaccgcctaccagctggtgcacgacgagctgatgctggac
ggcaactcccggctgaacctggccaccttcgtcaccacctggatggagccgcaggccggg
gtgctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacc
gccgagctggagcggcgctgcgtggcgatgctggccgacctgtggaacgcgccggacccg
tcggccgcggtgggctgctcgacgaccggctccagcgaggcgtgcatgctcgccgggatg
gcgctcaagcggcgctgggccaggcggaacgcggaccggtacccgggcgcgcggcccaat
ctggtgatggggatcaacgtccaggtctgctgggagaagttctgcgccttctgggaggtg
gaggcccggcaggtccccatggagggcgaccgcttccacctggacccgcaggccgccgcc
gagctgtgcgacgagaacaccatcggggtcgtcggcatcctcggctcgaccttcgacggc
tcctacgagccggtcgccgagctgtgcgcggccctggacgccctccaggagcgcaccggg
ctcgacatcccggtgcacgtcgacggggcgtccggcgggatggtggcgcccttcctggac
gaggacctggtgtgggacttccgcctgccccgcgtggcctcgatcaactgctcgggccac
aagtacgggctggtctacccgggcgtcggctgggcgctgtggcgggaccgggaggcgctg
cccgaggagctggtcttccgggtgaactacctgggcggcgagatgccgaccttcgcgctg
aacttctcccggcccggcgcccaggtggtggcgcagtactacacgttcctgcggctcggc
cgggagggctaccgggcggtgcagcggacgacgcgggacgtggcctgctcgctcgccggc
cggatcgcggcgctcggcgacttccggctgctcacgcgcggggaccagctgcccgtgttc
gcgctgaccacggccgacggcatcacgtcgtacgacgtcttcgacgtctcccggcggctg
cgcgagggcggctggctggtgcccgcgtacaccttcccggcccaccgcgaggacctgtcg
gtgctgcggatcgtgtgccgcaacggcttctcgcacgacctggccgacctgttcctggac
gacctgacccgcctgctgccggagctgcgccggcagccgcacccgctgacccgcgacaag
ggcgcggcgaccgggttccaccactag

DBGET integrated database retrieval system