KEGG   Streptomyces reticuli: TUE45_05771Help
Entry
TUE45_05771       CDS       T04246                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni] precursor
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
srw  Streptomyces reticuli
Brite
KEGG Orthology (KO) [BR:srw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TUE45_05771 (sodN)
Enzymes [BR:srw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TUE45_05771 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: CUW31034
UniProt: A0A0U5LTT9
LinkDB All DBs
Position
I:complement(6466369..6466764)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggag
aagatggccggcaacgacgacccccacttccaggcgcgcgccaccgtcatcaaggagcag
cgcgcggagctggccaagcaccacgtctccgtgctctggagcgactacttcaaggccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtccaccgacccggcgacgggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system