KEGG   Streptomyces reticuli: TUE45_06177Help
Entry
TUE45_06177       CDS       T04246                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
srw  Streptomyces reticuli
Pathway
srw00250  Alanine, aspartate and glutamate metabolism
srw00280  Valine, leucine and isoleucine degradation
srw00410  beta-Alanine metabolism
srw00640  Propanoate metabolism
srw00650  Butanoate metabolism
srw01100  Metabolic pathways
srw01120  Microbial metabolism in diverse environments
Module
srw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TUE45_06177 (gabT)
   00650 Butanoate metabolism
    TUE45_06177 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TUE45_06177 (gabT)
   00280 Valine, leucine and isoleucine degradation
    TUE45_06177 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TUE45_06177 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srw01007]
    TUE45_06177 (gabT)
Enzymes [BR:srw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TUE45_06177 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     TUE45_06177 (gabT)
Amino acid related enzymes [BR:srw01007]
 Aminotransferase (transaminase)
  Class III
   TUE45_06177 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: CUW31434
UniProt: A0A0U5LV01
LinkDB All DBs
Position
I:complement(6927588..6928922)
Genome map
AA seq 444 aa AA seqDB search
MTALPQERRVVTAIPGPKSQELQARRTAAVAQGVGSVLPVFTTRAGGGIIEDVDGNRLID
FGSGIAVTSVGASAEAVVRRASAQLADFTHTCFMVTPYEGYVEVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGFGPFAPE
VYRVPVAYGYRWPTGPENAGPEAAKQAIDQITKQVGPDNVAAIIIEPVLGEGGFIEPAKG
FLPAIRQFAADNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDAAHAGGLGGTYGGNPVACAGALGAIETMKELDLNGKAKRIEEVMKGRLAAMAE
KFDIIGDVRGRGAMIAIELVKDRTTKEPNPEATAALAKACHAEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFARI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacttccgcaggagcgccgcgtcgtcaccgccatccccggcccgaagtcgcag
gagcttcaggcccgccgtaccgccgcggtcgcgcagggcgtgggctccgtgctgcccgtg
ttcaccacgcgtgcgggcggcggcatcatcgaggacgtcgacggcaaccggctgatcgac
ttcggctcgggcatcgccgtgaccagcgtgggtgcgtccgccgaggccgttgtccggcgt
gcctccgcgcagctcgccgacttcacccacacctgtttcatggtcaccccgtacgagggc
tacgtggaggtcgcggaggcactggccgagctgaccccgggcgaccacgccaagaagtcc
gcgctgttcaactccggcgccgaggccgtggagaacgccgtcaagatcgcgcgtgcgtac
accaagcggcaggccgtcgtcgtgttcgaccacggttaccacgggcgcaccaacctcacc
atggcgctgaccgccaagaacatgccgtacaagcacggcttcgggccgttcgcgcccgag
gtctaccgggtgccggtcgcgtacggctaccgctggccgaccgggccggagaacgccggt
cccgaggccgccaagcaggccatcgaccagatcaccaagcaggtcggcccggacaacgtc
gccgcgatcatcatcgagcccgtcctcggcgagggcggcttcatcgagccggccaagggc
ttcctgcccgccatccgccagttcgccgcggacaacggcatcgtgttcgtcgccgacgag
atccagtccggtttctgccggacgggtcagtggttcgcgtgcgaggacgaggggatcgtc
ccggacctcatcaccaccgcgaagggcatcgccggcggtctgccgctcgccgccgtcacc
gggcgcgccgagatcatggacgccgcgcacgccggtggcctcggcggcacgtacggcggt
aaccccgtcgcctgcgccggtgcgctcggcgccatcgagacgatgaaggagctggacctc
aacggcaaggccaagcggatcgaggaggtcatgaagggccgcctcgccgccatggccgag
aagttcgacatcatcggtgacgtgcggggccgcggcgccatgatcgccatcgagctggtg
aaggaccgtacgaccaaggagccgaacccggaggccaccgccgcgctggccaaggcctgc
cacgccgagggcctgctggtgctcacctgcggcacctacggcaacgtgctccgcttcctg
ccgccgctggtcatcggcgaggacctgctgaacgagggcctcgacatcatcgagcaggcg
ttcgcgcgcatctga

DBGET integrated database retrieval system