KEGG   Streptomyces reticuli: TUE45_07025Help
Entry
TUE45_07025       CDS       T04246                                 

Gene name
davT_2
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
srw  Streptomyces reticuli
Pathway
srw00250  Alanine, aspartate and glutamate metabolism
srw00410  beta-Alanine metabolism
srw00640  Propanoate metabolism
srw00650  Butanoate metabolism
srw01100  Metabolic pathways
srw01120  Microbial metabolism in diverse environments
Module
srw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:srw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TUE45_07025 (davT_2)
   00650 Butanoate metabolism
    TUE45_07025 (davT_2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TUE45_07025 (davT_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TUE45_07025 (davT_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srw01007]
    TUE45_07025 (davT_2)
Enzymes [BR:srw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TUE45_07025 (davT_2)
Amino acid related enzymes [BR:srw01007]
 Aminotransferase (transaminase)
  Class III
   TUE45_07025 (davT_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CUW32276
UniProt: A0A0U5LV22
LinkDB All DBs
Position
I:7956845..7958128
Genome map
AA seq 427 aa AA seqDB search
MNDLYARHRRVLPDWLALYYDDPIEISHGEGRYVWDSAGRRYLDFFGGILTTLTAHALPE
VTKAVSEQAARIIHSSTLYLNRPMVELAERVAQVSGIPDARVFFTTSGTEANDTALLLAT
TYRRSNTLLAMRNSYHGRSFSAIGITGNRAWSPTSLSPLQTLYVHGGVRTRGPFAHLDDR
AFIDACVADLKDLLGHTRPPAALIAEPVQGVGGFTSPPDGLYAAFRQVLRDHGILWIADE
VQTGWGRTGDHFWGWQAHARSGPPDIVTFAKGIGNGMSVGGVIARAEIMNCLDAQSISTF
GGTQVTMAAALANLAYLLEHDLQGNARRVGGLLIERLRAVGAQLPGVREVRGRGLMIGVE
LVRPGTDEADPQALAAVLEAAREGGLLIGKGGGHDTSALRITPPLSLTVAEAEEGAALLE
HALRSTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctacgcccgccaccgccgggtcctgcccgactggctcgccctctactac
gacgacccgatcgagatcagccacggcgaggggcggtacgtctgggactccgccgggcgc
cggtacctggacttcttcggcggcatcctgaccacgctgaccgcgcacgcgctgcccgag
gtgaccaaggcggtcagcgagcaggccgcccggatcatccactcctccaccctctacctc
aaccggccgatggtcgaactcgccgagcgcgtcgcccaggtgagcggcatcccggacgcc
cgggtgttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctcgccacc
acctaccggcgcagcaacaccctgctcgccatgcggaacagctaccacggccggtccttc
agcgcgatcggcatcaccggcaaccgcgcctggtccccgacctccctgtccccgctgcag
accctgtacgtccacggcggcgtgcgcacccgggggcccttcgcccacctcgacgaccgt
gccttcatcgacgcctgtgtcgccgacctgaaggacctcctcggccacacccggccgccc
gccgcgctgatcgccgaacccgtccagggcgtcggcgggttcacctccccgcccgacggt
ctctacgccgccttccgccaggtcctgcgggaccacggcatcctgtggatcgccgacgag
gtgcagaccggctgggggcgcaccggcgaccacttctggggctggcaggcgcacgcccgc
agcggccccccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccgtcggt
ggcgtcatcgcccgcgccgagatcatgaactgcctggacgcccagagcatctccaccttc
ggcggcacccaggtcaccatggccgccgccctcgcgaacctcgcctacctcctcgaacac
gacctccagggcaacgcccggcgcgtcggcggcctgctcatcgagcggctgcgggcggtc
ggcgcccagctgcccggcgtccgggaggtgcgcggacgcgggctgatgatcggcgtcgaa
ctggtccggccgggcacggacgaggccgatccgcaggccctcgcggccgtcctggaggcg
gcccgggagggcgggctgctcatcggcaagggcggcgggcacgacaccagcgccctgcgg
atcaccccgccgctgtcgctgaccgtcgccgaggccgaggagggcgcggccctcctggag
cacgcgttgcggagcacgtactag

DBGET integrated database retrieval system