KEGG   Streptomyces reticuli: TUE45_pSRc_0399Help
Entry
TUE45_pSRc_0399   CDS       T04246                                 

Gene name
TUE45_pSRTUE45c_0399
Definition
(GenBank) Long-chain-fatty-acid-AMP ligase FadD26
Organism
srw  Streptomyces reticuli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding PP-binding SWM_repeat
Motif
Other DBs
NCBI-ProteinID: CUW33031
UniProt: A0A0U5HHY1
LinkDB All DBs
Position
II:complement(473743..475740)
Genome map
AA seq 665 aa AA seqDB search
MPAISSPAPPTLVHILRDRALQNPDGTAYVFLADGEDDERRLSYRQLYAAATDVAGALAD
RHGRGERALLLFAPGLDYITAFFGCLLAGVVAVPAYPPQDARSLGRLDAIVADAGARIAL
TTKDLLPITRSALDAPLAWVATDALEPGAGQAGAAAGSGGAAVTTTSEDLAFLQYTSGST
RLPRGVMLTHANLMHNLEAIYHSFAGTPHDVMVSWLPPYHDMGLIGAILEPLYGGFPGVL
MSPLHFLQKPYRWLKAISVHRGTISPSPNFGYELCLRKIDDEQRASLDLSTWRAAVNGAE
PVRVETVERFTERFAPAGFGPGTFRPSYGLAEATLLVTADPVGEPGRRFPVEGVTRIACG
TARGDQSVVVVDTATLAPAKAGQVGEIWVSGPSVSAGYWGRPTESAALFGATLPDGRGPY
LRTGDLGALDDEGALAVTGRLKDLLVLRGRNVYPHDVESAAEGSHPALRPGCGAAFTVPV
DGEERLVLVSEVTDGADTEAVTLAVRRAVREECDADLHELVLIPARTVPKTSSGKIQRRA
TREAYLSGALSRTGGWRAESAATAPGERAATPPRTPLESLIAGIWAELLGQEEVGVHDDF
FASGAQSLLLSQLAVRIEAELPVRVTTGDLFQASTVAKLAALLESRPLAVDEEQVAGLIA
RSDNG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaatatcgtcgccggcaccccctactcttgttcatatactccgggatcgagca
ttgcagaatcccgacggcaccgcatatgtttttctcgccgacggcgaggacgacgaacgg
cggctcagctatcggcagctgtacgcggcggccaccgacgtggccggcgcgctggccgac
cggcacgggcggggcgagcgggcgctgctcctcttcgccccgggcctcgactacatcacc
gcgttcttcggctgcctgctcgccggcgtcgtggccgtaccggcctatccgccgcaggac
gcgcgcagcctcggccggctggacgccatcgtcgccgacgcgggcgcccgcatcgccctg
accacgaaggatcttctgccgatcacccggtcggcgctggacgccccgctggcgtgggtc
gccaccgacgccctggagcccggagccggccaggccggcgccgcggccgggtccggcgga
gctgccgtgaccacgacgtccgaggacctcgcctttctgcagtacacctccggctccacc
cggcttccgcgcggtgtcatgctgacgcacgcgaatctcatgcacaatctggaggccatc
tatcattcctttgccgggaccccgcatgacgtcatggtcagctggcttccgccgtatcac
gacatgggacttatcggtgccatcctggaaccgctttacgggggttttccgggcgttctg
atgtcacctctgcatttcctgcagaagccgtatcgctggctgaaagcgatctccgttcac
cggggcacgatcagtccttccccgaatttcggatacgaactgtgcctgcggaagatcgac
gacgaacagcgggcgtcgctcgatctgtccacctggcgtgcggccgtcaacggagcggaa
ccggtccgggtggagacggtcgagcggttcacggagcggttcgccccggccggcttcggc
cccggcaccttccgtcccagctacggcctggcggaggccaccctgctggtgaccgccgac
ccggtgggcgagcccgggcgccgcttcccggtcgagggcgtgaccaggatcgcctgcggc
accgcccgcggcgaccagtccgtcgtcgtggtggacaccgccaccctggcaccggccaag
gccgggcaggtcggggagatctgggtgtccggtcccagtgtctccgcgggctactggggc
cgtcccaccgagagcgcggcgctgttcggcgccacgctgccggacggccgtggcccctac
ctgcgcaccggggatctgggggcgctggacgacgagggcgcgctcgccgtcacgggccgt
ctgaaggacctactcgtcctgcgtggccgcaatgtgtatccgcacgacgtggaaagcgcc
gccgaaggcagccaccccgccctgcggccgggttgcggcgcggccttcaccgttcccgtg
gacggcgaggagcggctggtcctggtgtccgaggtcaccgacggcgcggacaccgaagcc
gtcacgctcgcggtccggcgggcggtgcgcgaggagtgcgacgccgacctccacgaactg
gtgctcatcccggcccgcaccgtccccaagacctccagcggcaagatccagcgccgcgcg
acacgggaggcgtacctgtccggtgccctgtcccggaccggcggctggcgcgccgagagc
gcggcgacggcacccggcgagcgggccgccactcccccgcgtacgcccctggagtcgctg
atcgcgggcatctgggcggagttgctcggacaggaggaggtcggggtccacgacgacttc
ttcgcctcgggtgcgcagtccctgctgctgtcccagctcgccgtacgcatcgaggcggag
ctgccggtgcgggtcaccaccggtgacctgttccaggcgtcgaccgtcgcgaagctggcc
gcgctgctggagagcaggccgctcgccgtggacgaagaacaggtcgccggactgatcgcc
cggagcgacaacggctga

DBGET integrated database retrieval system