KEGG   Sinocyclocheilus rhinocerous: 107705087
Entry
107705087         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107705087
   04310 Wnt signaling pathway
    107705087
   04370 VEGF signaling pathway
    107705087
   04020 Calcium signaling pathway
    107705087
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107705087
   04218 Cellular senescence
    107705087
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107705087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107705087
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107705087
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107705087
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107705087
NCBI-ProteinID: XP_016363714
UniProt: A0A673H3V7
LinkDB
Position
Unknown
AA seq 511 aa
MSGKEQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKSHLVKEGRLEEDAALR
IINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRG
YFSIECVLYLWTLKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDSCMEAFD
CLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEK
SSEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLI
TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSDDELMSEGDDTCEGGAPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQ
LKGLTPTGTLPLGVLSGGRQTLESATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERM
PPRKDTMQPDGTANSMNAANSPDKNGTNAQA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtcggggaaggagcagaataaacaatccaccaccgaacggctcgtcaaagcagtgccg
taccctcccacgacgcggctcaccatgaaagagctgtatgaggacggcaagcccaaggtg
gagcttttgaagagccacctggttaaagagggccgcctggaggaagatgcggccctacgc
atcattaacgatggcgccaacatcctccgccacgagaaatgcatgctggaagtggaggcc
cccatcacagtgtgcggagatgtccatgggcagttttttgacctgatgaagctctttgag
gtggggggttccccgcacaacacacgctatctatttttgggagactatgtggatcgaggc
tatttcagtattgagtgtgtgctctatctgtggaccttgaagattaaccatccgaccacc
ctcttcctcctcagaggcaaccacgagtgtcggcatctcacggagtacttcacctttaaa
caagaatgcaagattaagtactcggagcgcgtgtatgattcctgcatggaggcctttgac
tgccttcctctggccgctctgctcaaccagcagttcctgtgcgttcacggaggcctatcc
cccgagatcacctgcctcgacgacatccggaaattagacaggttcaaagagccaccagct
ttcgggccgatgtgcgacctgctgtggtctgaccctggcgaggactacggcagcgaaaag
agctcggagcacttttgtcacaacagtgtgagaggatgttcctatttctacagttaccct
gcagtatgtgactttctgatgaataacaacttgttgtcagttataagagcacatgaagcc
caagatgcagggtatcgaatgtacagaaaaagtcagacgacaggcttcccctctttaatc
acaatcttctctgcaccaaactacttagatgtgtataacaataaagctgctgtgttgaaa
tatgagaataacgtcatgaacatccggcagttcaattgctctcctcacccatactggctg
cccaacttcatggatgtgttcacgtggtcactgccctttgtcggggagaaagtaacagag
atgctagtcaacgtgttaaacatctgctcagatgatgagctcatgtcagagggagatgac
acatgtgaaggtggcgccccggcagtccgcaaggaggtgatccgaaataagattcgtgcc
attggcaagatggccagagttttctctgttcttagagaggagaacgagagtgtgttgcag
ttaaagggcttgacccccactgggacgttgcctctgggtgtgctgtcaggaggcagacag
accctagagagcgccaccgtagaagcagaggaagcacgagccatccaaggcttcaaccct
caacacaagatccaaagcttcgaggaagcacgcggactggaccggataaacgagcgaatg
cctccacgcaaggacaccatgcagccagacggcactgccaactccatgaacgcagccaat
tcccccgacaagaacggcaccaatgcacaggcgtag

KEGG   Sinocyclocheilus rhinocerous: 107709853
Entry
107709853         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107709853
   04310 Wnt signaling pathway
    107709853
   04370 VEGF signaling pathway
    107709853
   04020 Calcium signaling pathway
    107709853
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107709853
   04218 Cellular senescence
    107709853
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107709853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107709853
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107709853
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107709853
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 107709853
NCBI-ProteinID: XP_016369986
LinkDB
Position
Unknown
AA seq 509 aa
MSTKEPKENLSTTERIIKTVPLPPHQRLTIKDLFVDGKPNAELLKNHLIKEGRVEEDVAL
RIINEGANILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDR
GYFSIECVLFLWTLKINHPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYETCMEAF
DCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSE
KTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSLIRAHEAQDAGYRMYRKSQTTGFPSL
ITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVT
EMLVNVLNICSDDELMSEGDDLCEAGGAPAVRKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGTLPLGVLSGGKQTLQNATIEAKEGQAIQGFSPTRKIRNFEEARGLDRINE
RMPPRKDGQQPDGTTVNTANEKNGTDGNV
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtcgactaaagagccgaaagaaaacctgtcgaccaccgaacgaatcattaaaacagtg
ccactgccccctcaccagcggctgacaataaaggacctatttgtggatggtaagccaaat
gccgagctactgaagaaccatttgatcaaagagggacgtgtggaggaggacgttgcgctg
cgcatcataaacgagggtgccaacatcctaaggcaggagaagtgcatgctagaggtggag
gcaccaatcactgtatgtggtgatgttcacggacagttcttcgacctcatgaagctcttt
gaagttggtggttcccccgacaacacgcgctatctcttcctgggcgattatgtagaccga
ggatacttcagtattgagtgtgtgctgttcctgtggacattgaagatcaaccatcccaac
accctcttcctcctcagaggcaaccatgagtgtcggcacctcacagaatacttcaccttc
aaacaggaatgtaaaataaagtattcagagagggtttatgagacatgtatggaggccttc
gactgcttgcctcttgcagctcttctaaaccagcagttcctctgtgtacacggtggcctc
tcaccagaaatcaactgcttagatgacattaggaaattagacaggtttaaggagccccca
gcatttgggcctatgtgtgatttgatctgggccgacccgggagaggactacggcagtgag
aagacggcagagcactttaaccacaactcagtcagaggctgctcctatttcttcagttat
gcagcagtttgtgactttctgacaaacaacaacctgttgtcattaatcagagcacatgaa
gcacaagacgcagggtacaggatgtacagaaaaagtcagacaacaggcttcccttcatta
attaccattttctcagcaccaaattacctagatgtctataacaacaaagcggctgtattg
aaatatgaaaacaatgtcatgaacattagacagttcaactgctctcctcacccgtactgg
ttacccaacttcatggatgtgtttacgtggtcgctgccctttgtgggcgagaaagtgact
gagatgttggtgaatgtcctaaacatctgctctgatgatgaactcatgtcagagggagac
gacttgtgtgaagcaggtggagctccagctgtccgtaaggaggtgatcagaaataagatc
cgtgccattgggaaaatggccagagtcttttctgttctcagggaagaaagtgagagtgta
ctgaccctcaaagggctcaccccaaccggaacgctacctctaggagtgttgtctggaggc
aagcagaccttacagaatgccaccatagaagcaaaggagggtcaagccatccaaggtttc
tctcctacacggaaaatccgcaacttcgaagaagctcgtggcctggaccgaataaacgaa
cggatgcctcctcgcaaggacggccagcaacctgacggtaccacagttaacactgccaac
gagaaaaacggcactgacgggaatgtgtga

KEGG   Sinocyclocheilus rhinocerous: 107715410
Entry
107715410         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107715410
   04310 Wnt signaling pathway
    107715410
   04370 VEGF signaling pathway
    107715410
   04020 Calcium signaling pathway
    107715410
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107715410
   04218 Cellular senescence
    107715410
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107715410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107715410
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107715410
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107715410
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107715410
NCBI-ProteinID: XP_016377027
LinkDB
Position
Unknown
AA seq 521 aa
MKMSNADMVLNSTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVA
LRIVNEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVD
RGYFSIECVLYLWSLKLLYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMGA
FDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGN
EKSQEYFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV
TEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENV
LTLKGLTPTGMLPSGVLSGGKQTLQSATTEAIEAIETDEDGEAIRGFSPQHKINSFAEAK
GLDRINERMPPRKDGVNHVGHSMGKMNMSETNGTDDNSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaagatgtctaacgctgacatggtcttgaactccaccgatcgggtagtgaaatccgtt
cccttccccctgagtcatcgcctcaccatgaaggaggtgtttgactgtgaggggaaacca
agggtggatctactgaaagcccacctcactaaagagggccgagtggaggagaccgtggcc
ctccgaatcgtaaacgaaggggcctctatcttacgccaggagaagaccatgctggacata
gaggcacctgtcacagtgtgcggtgacatccatgggcagttctttgacctgatgaaactg
tttgaggtgggaggctctccagccaccacacgatacctcttcctgggcgactatgtggac
cggggttacttcagtattgagtgtgttctgtacctctggtcactgaaactcctctaccca
aaaacgctatttttactgagaggaaatcatgaatgtagacatttgacagaatatttcacc
ttcaaacaagaatgtaaaatcaagtattcagagcaggtttacgatgcctgtatgggcgcg
tttgactgtctgcccttggcagctctcatgaaccagcagttcctgtgcgtccacggtggc
ctgtccccagaaatacagaccttagatgacataaagaagttggaccggtttaaggagccc
ccagcattcgggcctatgtgtgatttgctttggtccgatcccctggaggacttcggcaat
gaaaagagccaagagtactttagccacaacacagtcagaggatgctcatacttctacagt
tatccggctgtctgtgacttcctacagaataataacttgttatcaatcatccgagcacac
gaagcacaagatgcagggtatcggatgtacaggaagagtcagactactggcttcccttcc
ctaattaccatcttctctgcaccaaactaccttgatgtttacaacaataaagctgccgtt
ctgaagtatgagaacaatgtaatgaacatccggcagtttaactgctcccctcatccttac
tggctgccaaatttcatggatgtctttacctggtcacttccatttgtgggggagaaagtc
acggagatgctggtaaatgtgttgagcatctgttctgacgatgagctgatgaatgatgga
gacgagatctttgacgccaatgcagcagctgctcggaaagaggtgattaggaacaagatc
cgtgccattgggaagatggccaagatgttctccgtgctcagagaggagagtgagaatgtg
ttgaccctgaagggcctgacccctaccggcatgctgcccagcggggtgctttctggaggc
aagcagactctgcagagtgcaaccaccgaagccattgaagccatcgagacggatgaagac
ggagaagccatccgcggcttctctccacagcacaagatcaacagctttgcagaggctaaa
ggtctggaccgcatcaacgagcgcatgccaccccgcaaggatggagtcaaccacgtgggc
cactccatgggcaagatgaacatgtccgagaccaacggcaccgacgacaacagtaacatc
cagtga

KEGG   Sinocyclocheilus rhinocerous: 107719301
Entry
107719301         CDS       T04916                                 

Definition
(RefSeq) calcineurin subunit B type 1-like isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107719301
   04310 Wnt signaling pathway
    107719301
   04370 VEGF signaling pathway
    107719301
   04020 Calcium signaling pathway
    107719301
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107719301
   04218 Cellular senescence
    107719301
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107719301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107719301
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107719301
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107719301
NCBI-ProteinID: XP_016382215
LinkDB
Position
Unknown
AA seq 185 aa
MALRYGAMGKPLCVVTRTRPAAAKDPVTGFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS
LPELQQNPLVQRVIEIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG
YISNGELFQVLKMMVGNNLKDTQLQQIVDKTIVNADKDGDGRISFEEFCAVVGGLDIHKK
MVVDV
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctcttcggtacggtgcgatgggtaaacctctgtgtgtggtgactcgcacgaggcca
gcggcagccaaggatcccgtcacgggattcgatgctgatgagattaaaaggctgggaaag
aggtttaagaaactcgacctagataactccggatccctcagcgtggaggagttcatgtcc
ttgcccgagttacagcagaatccactggtgcagagagtcatcgagatattcgacacggac
ggcaacggagaggtggacttcaaagagttcatagagggcgtctctcagttcagtgtgaag
ggcgataaggagcagaaactgcgcttcgcttttaggatctatgacatggacaaggacggc
tacatttccaacggagagctgttccaggtgttgaagatgatggtgggcaacaatctgaag
gacactcagctgcagcagatagtggacaagaccatcgtcaacgcagacaaggacggtgat
gggagaatatccttcgaggagttctgtgctgtcgtcggaggtctggatatacacaagaag
atggtggtggatgtgtga

KEGG   Sinocyclocheilus rhinocerous: 107720725
Entry
107720725         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107720725
   04310 Wnt signaling pathway
    107720725
   04370 VEGF signaling pathway
    107720725
   04020 Calcium signaling pathway
    107720725
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107720725
   04218 Cellular senescence
    107720725
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107720725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107720725
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107720725
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107720725
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107720725
NCBI-ProteinID: XP_016384032
UniProt: A0A673LQX4
LinkDB
Position
Unknown
AA seq 511 aa
MSGKEQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKSHLVKEGRLEEDAALR
IINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRG
YFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFD
CLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEK
SSEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLI
TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSDDELMSEGDDTCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQ
LKGLTPTGTLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERM
PPRKDSMQPDGTANSINAANSPDKNGTNAQA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtcggggaaggagcagaataaacaatccaccaccgaacggctcgtcaaagcagtgccg
taccctcccacaacgcggctcaccatgaaagagctgtacgaggacggcaagcccaaggtg
gagcttttgaagagccacctggtgaaagaggggcgcctggaggaagacgcagccctacgc
atcatcaacgatggcgcaaacatcctccgccatgagaaatgcatgctggaagtggaggcc
cccatcacagtgtgcggagatgtccatgggcagttttttgacctgatgaagctctttgag
gtggggggttccccgcacaatacacgctatctatttttgggagactatgtggatcgaggc
tatttcagtattgagtgtgtgctctatctgtgggccctgaagatcaaccacccgaccacc
ctcttcctcctcagaggcaaccacgagtgtcggcatctcacggagtacttcacctttaaa
caagaatgcaagattaagtactcggagcgcgtgtatgacgcctgcatggaggcctttgac
tgccttcccctggccgctctgctcaaccagcagttcctgtgcgttcacggaggcctgtcc
cccgagatcacctgcctcgacgacatccggaaattagaccggtttaaagagcctccagct
ttcgggccgatgtgcgacctgctgtggtctgaccctggcgaggactacggcagcgaaaag
agctcggagcacttttgtcacaacagtgtgagaggatgttcctatttctacagttaccct
gcagtgtgtgactttctgatgaataataacttgttgtcagttataagagcacatgaagcc
caagacgcagggtatcgaatgtacagaaagagtcagacgacaggcttcccctctttaatc
acaatcttctctgcaccaaactacttagatgtgtataacaataaagctgctgtgttgaaa
tacgagaacaacgtcatgaacatccggcagttcaattgctctcctcacccgtactggctg
cccaacttcatggacgtgttcacgtggtcactgcccttcgtcggggagaaagtaacagag
atgctggtcaacgtgttaaacatctgctcagatgatgagctcatgtcagagggagacgac
acatgtgaaggtggcaccccggcagtccgcaaggaggtgatccgaaataagattcgtgcc
attggcaagatggccagagttttctctgttcttagagaggagaatgagagtgtgttgcag
ttaaagggcttgacccccactgggacgttgcctctgggtgtgctatcaggaggcagacag
accctacagagcgccaccgtagaagcagaggaagcacgagctatccaaggcttcaaccct
caacacaagatccaaagcttcgaggaagcacgcggactggaccggataaacgagcgaatg
cctccgcgcaaagacagcatgcagccagacggcactgccaactccatcaacgcagccaat
tcccccgacaagaacggcaccaacgcacaggcgtag

KEGG   Sinocyclocheilus rhinocerous: 107721549
Entry
107721549         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107721549
   04310 Wnt signaling pathway
    107721549
   04370 VEGF signaling pathway
    107721549
   04020 Calcium signaling pathway
    107721549
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107721549
   04218 Cellular senescence
    107721549
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107721549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107721549
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107721549
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107721549
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 107721549
NCBI-ProteinID: XP_016385111
LinkDB
Position
Unknown
AA seq 508 aa
MSTKEPKEKLSTTERIIKTVPLPPHQRLTVKDLYVDGKPNAEILKNHLIKEGRVEEDVAL
RIINEGASILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDR
GYFSIECVLFLWTLKINHPNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAF
DCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSE
KTAEHFNHNSVRGCSYFFSYAAVCDFLTNNNLLSVIRAHEAQDSGYRMYRKSQTTGFPSL
ITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVT
EMLVNVLNICSDDELMSEGDDLCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREESESVL
TLKGLTPTGTLPLGVLSGGKQTLQNAAIEAKEGGAIQGFSPTRKIRNFEEARGLDRINER
MPPRKDGQQPDGTTVKTANEKNGTDGNV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcgaccaaagagccgaaagaaaagctgtcgaccactgaacgaattattaaaacagtg
ccactgccccctcaccagcggctgacagtgaaggacctatatgtggatggtaagcccaat
gctgagatactgaagaaccatttgatcaaagagggacgtgtggaggaggacgttgcgctg
cgcatcataaacgagggtgccagcatcctaaggcaggagaagtgcatgctagaggtggag
gctccaatcactgtatgtggtgacgttcacggacagttcttcgacctcatgaagctcttt
gaagttggtggttcccccgacaacacgcgctatctcttcctgggcgattatgtggacaga
ggatacttcagtattgagtgtgtgctgttcctgtggacattgaagatcaaccaccccaac
accctcttcctcctcagaggcaaccatgagtgtcggcacctcacagaatacttcaccttc
aaacaggaatgtaaaataaagtattcagagagggtttatgacgcatgtatggaggccttt
gactgcttgcctcttgcagctcttctaaaccagcagttcctctgtgtacatggtggcctc
tcaccagaaatcaactgcttagatgacattaggaaattagacaggtttaaggagcccccg
gcatttgggcctatgtgtgatttgatctgggccgacccgggagaggactatggcagtgag
aagacggcagagcattttaaccacaactccgtcagaggctgctcctatttcttcagttat
gcagcagtctgtgactttctgacaaacaataacctgttgtcagtaattagagcacatgaa
gcacaggactcagggtacaggatgtacagaaaaagtcagacaactggcttcccttcatta
attaccattttctcagcaccaaattacctagatgtctataacaacaaagcggctgtattg
aaatatgaaaacaatgtcatgaacattaggcagttcaactgctctcctcacccgtactgg
ttacccaactttatggatgtgtttacgtggtcgctgccctttgtgggcgagaaagtgact
gagatgttggtgaatgtcctaaacatctgctctgatgatgaactcatgtcagagggagac
gacttatgtgaaggtggaactccagctgtccgtaaggaggtgatcagaaataagatccgt
gccattgggaaaatggccagagtcttttctgttctcagggaagagagcgagagtgtactg
accctcaaagggctcaccccaactggaacactacctctaggagtgttgtctggaggcaag
cagaccttacagaatgcagccatagaagcaaaggagggtggagccatccaaggcttctct
cctacacggaaaatccgcaacttcgaagaagctcgtggcctggaccgaataaacgaacgg
atgcctcctcggaaggacggccagcaacctgacggtaccacagttaaaactgccaacgag
aaaaacggcactgatgggaatgtgtaa

KEGG   Sinocyclocheilus rhinocerous: 107726551
Entry
107726551         CDS       T04916                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107726551
   04310 Wnt signaling pathway
    107726551
   04370 VEGF signaling pathway
    107726551
   04020 Calcium signaling pathway
    107726551
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107726551
   04218 Cellular senescence
    107726551
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107726551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107726551
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107726551
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107726551
NCBI-ProteinID: XP_016391665
LinkDB
Position
Unknown
AA seq 128 aa
MRLIHHPLPVWEVLADLCLSLTVLSQPTCPKINIKDHWERVGEMDVEGEKETESRRFAFR
IYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIVNADKDGDGRISFEEFCAIT
DTSKSAKP
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcgtctcattcaccacccgcttcctgtgtgggaagttctggccgatctctgtctctct
ctaactgtcctgagccagccaacgtgcccaaaaataaatatcaaagatcactgggagagg
gtgggagaaatggatgtagaaggagagaaagaaacagagtctcgcagattcgcttttagg
atctatgacatggacaaggacggctacatttccaacggagagctgttccaggtgttgaag
atgatggtgggcaacaatctgaaggacactcagctgcagcagatagtggacaagaccatc
gtcaacgcagacaaggacggtgatgggagaatatccttcgaggagttctgtgctatcaca
gatacgagcaaatcagcaaagccgtga

KEGG   Sinocyclocheilus rhinocerous: 107727894
Entry
107727894         CDS       T04916                                 

Definition
(RefSeq) calcineurin subunit B type 1 isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107727894
   04310 Wnt signaling pathway
    107727894
   04370 VEGF signaling pathway
    107727894
   04020 Calcium signaling pathway
    107727894
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107727894
   04218 Cellular senescence
    107727894
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107727894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107727894
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107727894
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107727894
NCBI-ProteinID: XP_016393417
LinkDB
Position
Unknown
AA seq 178 aa
MGKPLCVVTCARPAAAKDPVTGFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQN
PLVQRVIEIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGEL
FQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 537 nt   +upstreamnt  +downstreamnt
atgggtaaacctctgtgtgtggtgacctgcgcgaggccagcggcagccaaggatcccgtc
acgggattcgatgctgatgagattaaaaggctgggaaagaggtttaagaaactcgaccta
gataactccggatccctcagcgtggaggagttcatgtccttgcccgagttacagcagaat
ccactggtgcagagagtcatcgagatattcgacacggacggcaacggagaggtggacttc
aaagagttcatagagggcgtctctcagttcagtgtgaagggcgataaggagcagaaactg
cgcttcgcttttaggatctatgacatggacaaggacggctacatttccaacggagagctg
ttccaggtgctgaagatgatggtgggcaacaatctgaaggacactcagctgcagcagata
gtggacaagaccatcatcaacgcagacaaggacggcgatgggagaatatccttcgaggag
ttctgtgctgtcgtcggaggcctggatatacacaagaagatggtggtggatgtgtga

KEGG   Sinocyclocheilus rhinocerous: 107731730
Entry
107731730         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107731730
   04310 Wnt signaling pathway
    107731730
   04370 VEGF signaling pathway
    107731730
   04020 Calcium signaling pathway
    107731730
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107731730
   04218 Cellular senescence
    107731730
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107731730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107731730
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107731730
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107731730
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107731730
NCBI-ProteinID: XP_016398377
LinkDB
Position
Unknown
AA seq 492 aa
MREVFDYEGKPRVDLLKAHLTKEGRLEEPVALRIINEGAAILRQEKTMLDIEAPVTVCGD
IHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWSLKILYPKTLFLLRGN
HECRHLTEYFTFKQECKIKYSEQVYDVCMDAFDCLPLAALMNQQFLCVHGGLSPEIHTLD
DIKKLDRFKEPPAFGPMCDLLWSDPLEDFGNEKSQDYFSHNSVRGCSYFYSYPAVCEFLQ
TNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMN
IRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAA
AARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSATI
EAIEAVETVEDGEAIRGFSPQHKINSFEEAKGLDRINERMPPRRDVVNSVGLSMGKMNMA
ESNGTDDNSNIQ
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcgagaggtgttcgactatgaggggaaaccgcgtgtggacctgctgaaggctcacctc
actaaagagggtcgcttggaggagcctgtcgccctgcgtatcatcaacgagggggccgcc
atcctccgccaggagaagaccatgctggacatagaggcccctgtcacagtgtgcggggat
attcacgggcagttcttcgacctgatgaagttatttgaggtcggcgggtctcctgcgaca
acgaggtacttgtttctaggggactatgtggaccgagggtacttcagtattgagtgtgtc
ctttacctctggtcgctgaaaatcctctacccaaagacgctgtttctgctgcggggaaac
catgaatgtagacatttgactgaatatttcactttcaaacaagaatgtaaaatcaaatac
tcggagcaggtgtatgatgtgtgcatggatgcattcgactgtctgcctctggctgctctg
atgaatcagcagtttttgtgtgttcatggtggcctgtctccagagatacacacgttagac
gacatcaagaagctggacaggttcaaggaaccgccagcgtttggccccatgtgtgatctg
ctgtggtccgacccgctggaggacttcggcaatgaaaagagtcaagattacttcagccac
aacagtgtccgcggatgctcctacttctacagctatcctgcggtgtgtgagtttttacag
accaacaacttactgtctgtcatcagagcacatgaggcgcaggacgcgggttaccgtatg
tacaggaagagtcagactacaggttttccttctctcatcaccatcttttctgctccaaac
tacctggacgtttacaacaacaaagcggccgtgcttaaatacgagaacaacgtaatgaac
atacgacagttcaactgctcgccacatccgtactggctgcccaacttcatggacgtcttc
acctggtctcttccgttcgttggggagaaagtgacagaaatgttggtgaatgtcctcagt
atctgctctgatgatgagcttatgaacgacggagatgagatcttcgatgctaacgctgcg
gctgcccgtaaagaggttatcagaaacaagatccgtgccatcggcaaaatggccaaaatg
ttttcagtcctgcgagaggagagtgagaatgtgttaaccctgaaaggtctgacccccact
ggcatgctgccgagcggcgtactgtctggaggaaaacagaccttgcagagcgctaccatc
gaggccattgaagccgtggagacggttgaggatggagaagccatccgtggcttttctcca
cagcataagatcaacagtttcgaggaggcgaagggtctggaccgcataaacgagcgaatg
ccgcctcgccgagacgtggtcaacagcgtggggctgtcaatgggcaagatgaacatggcc
gaatccaacggcacggacgacaacagcaatatccagtga

KEGG   Sinocyclocheilus rhinocerous: 107733504
Entry
107733504         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107733504
   04310 Wnt signaling pathway
    107733504
   04370 VEGF signaling pathway
    107733504
   04020 Calcium signaling pathway
    107733504
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107733504
   04218 Cellular senescence
    107733504
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107733504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107733504
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107733504
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107733504
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107733504
NCBI-ProteinID: XP_016400634
LinkDB
Position
Unknown
AA seq 521 aa
MKMSNADMVLNSTDRIVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVA
LRIINDGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVD
RGYFSIECVLYLWSLKMLYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMGA
FDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFGN
EKSQEYFSHNSVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV
TEMLVNVLSICSDDELINDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENV
LTLKGLTPTGMLPSGVLSGGKQTIQSATVEAIEAIETEEDGEAIRGFSPQHKINSFEEAK
GLDRINERMPPRKDGVNHVGHSMGKMNMSETNGTDDNSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaagatgtctaacgctgacatggtcttgaactccaccgatcggatagtgaaatccgtt
cccttccccctgagtcaccgcctcaccatgaaggaggtgtttgactgtgaggggaaacca
agggtggatctactgaaagcccacctcactaaagagggccgagtggaggagaccgtggcc
cttcgaatcataaatgatggggcctctatcttacgccaggagaagaccatgctggacata
gaggcacctgtcacagtgtgcggtgacatccatgggcagtttttcgacctgatgaaactg
tttgaggtgggaggctctccagccacgacacgatacctcttcctgggtgactatgtggac
cggggttacttcagtatcgagtgtgttctgtacctctggtcactgaaaatgctctaccca
aagacgctatttttactgagaggaaatcatgaatgtagacatttgacagaatatttcacc
ttcaaacaagaatgtaaaatcaagtattcagagcaggtttacgatgcctgtatgggcgca
tttgactgtctgcccttggcagctctcatgaaccagcagttcctgtgtgtccacggtggc
ctgtccccagaaatacagaccttagacgacataaagaagttggaccggtttaaggagccc
ccagcatttgggcctatgtgtgatttgctttggtccgatcccttggaggacttcggcaat
gaaaagagccaagagtactttagccacaactcagtcagaggatgctcatacttctacagt
tatccggctgtctgtgacttcctacagaataataacttgttatcaatcattcgagcacat
gaagcacaagatgcagggtaccggatgtacaggaagagtcagaccactggcttcccttcc
cttattaccattttctctgcgccaaactaccttgatgtttacaataataaagctgccgtc
ctgaagtatgagaacaatgtaatgaacatccgacagtttaactgctcccctcatccttac
tggctgccaaatttcatggatgtcttcacctggtcgctgccatttgtgggggagaaagtc
acggagatgctggtaaatgtgttgagcatctgttctgatgatgagctgataaatgatgga
gacgagatctttgacgccaatgcagcagctgcccgaaaagaggtgattaggaacaagatc
cgtgccattgggaagatggccaagatgttctccgtgctcagagaggagagtgagaatgtg
ttgaccctgaagggtctgacccctaccgggatgctcccaagtggggtgctttctggaggc
aagcagactatacagagtgcaaccgtcgaagccattgaagccatcgagacggaagaagac
ggagaagccatccgcggcttctctccacagcacaagatcaacagcttcgaagaggctaaa
ggtctggaccgcatcaacgaacgcatgccgccccgcaaggatggagtcaaccacgtgggc
cactccatgggcaagatgaacatgtccgagaccaacggcaccgacgacaacagtaacatc
cagtga

KEGG   Sinocyclocheilus rhinocerous: 107743942
Entry
107743942         CDS       T04916                                 

Gene name
ppp3ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107743942 (ppp3ca)
   04310 Wnt signaling pathway
    107743942 (ppp3ca)
   04370 VEGF signaling pathway
    107743942 (ppp3ca)
   04020 Calcium signaling pathway
    107743942 (ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107743942 (ppp3ca)
   04218 Cellular senescence
    107743942 (ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107743942 (ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107743942 (ppp3ca)
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107743942 (ppp3ca)
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107743942 (ppp3ca)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107743942
NCBI-ProteinID: XP_016412886
LinkDB
Position
Unknown
AA seq 529 aa
MSENKPNDDPKLSTTDRVVKSVPFPPSHRLTVKEVFDSEGKPKVDVLKAHLTKEGRVEES
VALRLIGEGAAILRSEKNLLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDY
VDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDTCM
DAFDCLPLAALMNQQFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDF
GNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGF
PSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGE
KVTEMLVNVLSICSNDELTTDEEIDGQLIYGPKKGATASARKEVIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNETAATIEAIEADEAIKGFSPQHKIS
SFEEAKGLDRINERMPPRRDASLNSLNKALSSETNGTEGKACSGSGNIQ
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtctgaaaacaaaccaaatgatgatccgaagttgtccacgacggacagagtggttaaa
tctgtcccgtttcccccaagtcaccgactgactgtgaaagaggtgtttgacagtgagggc
aaacccaaagtagatgttctgaaggcccacctcactaaagaggggcgtgtggaagagagt
gtggcacttcgattaattggcgagggagcggcaatcctccgttcggagaagaacctcctg
gacatagaagccccagtgacagtttgtggagacattcatgggcagttctttgacttgatg
aagctctttgaggtaggagggtctccagccagcacacgataccttttccttggtgattat
gtggacagaggatatttcagtattgaatgtgtactgtacctatgggccttaaaaatcctt
tatcccaagacactgtttttgctgcgtgggaaccacgaatgtagacatttaacagagtat
ttcacttttaaacaggaatgtagaattaaatattcagagcgggtgtatgatacgtgtatg
gatgcctttgactgtcttcccctggcagcgttgatgaaccagcagttcttgtgtgtgcac
ggtggattgtcccccgaaatcacaaaccttgatgacatcaggaaattagacagattcaaa
gagcctcctgcatatggaccaatgtgtgacttgctttggtcggacccactggaggacttt
ggcaacgagaaaacccaggaacatttcacacacaacacagtgagaggctgctcctatttc
tacagttatcctgctgtgtgtgactttctacaacacaacaacttattatctatcatacga
gcccatgaagcacaggatgctgggtatcgcatgtacagaaagagtcaaactacaggcttc
ccctctctcatcactatcttctcagctcccaactacttagatgtctacaataacaaagct
gctgtcctgaaatatgagaataatgtcatgaacattcggcagtttaactgttctcctcat
ccttactggctgcctaacttcatggatgtcttcacttggtccttgccttttgttggggag
aaagtgactgagatgcttgtgaatgtcttgagcatctgctccaatgatgagctgaccact
gatgaagagatagatggacagctaatatatgggcccaagaaaggtgccacggcttctgca
cgcaaggaggtaatcagaaacaagatccgtgccattggaaagatggctcgggttttctca
gttcttcgagaggagagtgagagcgttttgacgttgaagggtctcactccaactggcatg
ctacccagtggcgttctgtctggaggcaaagagaaactccagaatgaaactgcagctact
attgaggctatagaggcagatgaagcaattaaaggcttctcacctcagcacaagatcagc
agctttgaggaggctaaagggctggaccgcatcaatgagcgaatgccaccccgccgtgac
gccagcctcaactcccttaataaggctctgtcatcagagaccaatggcacagagggcaag
gcctgcagcggcagcggtaatatccagtga

KEGG   Sinocyclocheilus rhinocerous: 107747434
Entry
107747434         CDS       T04916                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107747434
   04310 Wnt signaling pathway
    107747434
   04370 VEGF signaling pathway
    107747434
   04020 Calcium signaling pathway
    107747434
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107747434
   04218 Cellular senescence
    107747434
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107747434
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107747434
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107747434
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 107747434
NCBI-ProteinID: XP_016417419
LinkDB
Position
Unknown
AA seq 198 aa
IRRLKARGEENPCDLLAQKNNRQRQQQRPFSSARLRTRRRQARRQHVDADEIKRLGKRFK
KLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDK
EQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKGFHMRL
ANQVVGGLDIHKKMVVDV
NT seq 597 nt   +upstreamnt  +downstreamnt
atccgtcgactgaaagcccgaggagaagaaaatccctgcgacttgctcgctcagaaaaat
aaccgtcagcgacagcagcagcgaccgttcagttccgcgagactccgcacaaggcgaaga
caagcccggcgacagcatgttgacgctgatgagattaaaagactagggaagcggtttaag
aaactcgacctggataactcgggttctctcagcgtggaggagtttatgtctctacccgag
ttgcagcagaatccgctggtgcagcgagttattgatatattcgacacagacggaaatgga
gaagtggactttaaagagttcattgaaggcgtctctcagttcagtgtcaagggtgacaag
gagcagaagctccgctttgcgttcaggatttatgacatggataaggatggctacatatcc
aacggtgagctgttccaggtgctgaagatgatggtagggaataacctgaaggacacccag
ctgcagcagatcgtcgacaaaaccatcatcaacgcagacaagggttttcatatgcgtttg
gccaatcaagtggttggtggcttagacattcacaaaaagatggtggtggatgtgtga

KEGG   Sinocyclocheilus rhinocerous: 107757036
Entry
107757036         CDS       T04916                                 

Definition
(RefSeq) calcineurin subunit B type 1-like isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107757036
   04310 Wnt signaling pathway
    107757036
   04370 VEGF signaling pathway
    107757036
   04020 Calcium signaling pathway
    107757036
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107757036
   04218 Cellular senescence
    107757036
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107757036
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107757036
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107757036
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107757036
NCBI-ProteinID: XP_016429872
UniProt: A0A673G9V6
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCIVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggagatgtgctcacactttgatgctgatgagatt
aaaagactaggaaagcggtttaagaaactcgacctggataactcgggttctctcagcgtg
gaggagtttatgtctctacccgagttgcagcagaacccgctggtgcagcgagtcatcgat
atattcgacacagacggaaatggagaagtggattttaaagagttcattgaaggcgtctct
cagttcagcgtcaagggcgacaaggagcagaagctccgctttgcgttcaggatttatgac
atggataaggatggctacatatccaacggtgagctgttccaggtgctgaagatgatggta
gggaataacctgaaggacacccagctgcagcagatcgtcgacaaaaccatcatcaacgca
gacaaggatggggacgggaggatatctttcgaggagttctgcattgtggttggtggctta
gacattcacaaaaagatggtggtggacgtgtga

KEGG   Sinocyclocheilus rhinocerous: 107758531
Entry
107758531         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04020  Calcium signaling pathway
srx04114  Oocyte meiosis
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107758531
   04310 Wnt signaling pathway
    107758531
   04370 VEGF signaling pathway
    107758531
   04020 Calcium signaling pathway
    107758531
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107758531
   04218 Cellular senescence
    107758531
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107758531
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107758531
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107758531
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107758531
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107758531
NCBI-ProteinID: XP_016431772
LinkDB
Position
Unknown
AA seq 522 aa
MRMSSADIVGLNPTDRVIKSVPFPLSHRLSMREVFDCEGKPRVDLLKAHLTKEGRLEEPV
ALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYV
DRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDTCMD
AFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWADPLEDFG
NEKSQDYFSHNSVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLSICSDDELMNDEDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESEN
VLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAVETDEDGEAIRGFSPQHKITSFEEA
KGLDRINERMPPRRDVVNSVGLSMGKMNMAESNGTDDNSNIQ
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagaatgtccagcgcagacatcgtgggtttaaaccctaccgaccgcgtgatcaaatct
gtgccgtttccgctgagccacaggttaagcatgcgagaggtgttcgactgcgaggggaaa
ccgcgtgtggacctgctgaaggctcacctcactaaagagggccgcttggaggagcccgta
gctctgcgcatcatcaacgagggggccgccatcctccgtcaggagaagaccatgctggac
atagaggcccctgtcacagtgtgcggggatattcacgggcagttcttcgacctgatgaag
ttatttgaggttggcgggtctcctgcaacaacgaggtatctgtttctaggggactatgtg
gaccgagggtacttcagtattgagtgtgtcctttacctctggtcgctgaaaatcctctac
ccaaagacgctgtttctgctgcggggaaaccatgaatgtagacatttgactgaatatttc
actttcaaacaagaatgtaaaatcaaatactcggagcaggtgtacgacacgtgcatggat
gcattcgactgtctgcctctggctgctctgatgaatcagcagtttttgtgtgttcatggc
ggcctgtctccagagatacacacattagatgacattaagaggctggacaggttcaaggaa
ccgccagcatttggccccatgtgtgatctgctctgggctgacccgctggaggacttcggc
aatgaaaagagtcaagattacttcagccacaacagtgtccgcggatgctcctacttctac
agctatcctgcagtgtgtgagtttttacagaccaacaacttactgtctgtcatcagggca
catgaggcacaggatgcgggttaccgtatgtacaggaagagtcagactacaggtttccct
tctctcatcaccatcttctctgctccaaactacctggacgtttacaacaacaaagcggcc
gtgcttaaatacgagaacaacgtaatgaacatacgacagttcaactgctcgccacatcca
tactggctgcccaacttcatggacgtcttcacctggtctcttccgttcgttggagagaaa
gtgacagaaatgttggtgaatgtcctcagtatctgctctgatgatgagcttatgaacgat
gaagatgagatctttgatgctaatgctgcggccgcccgtaaagaggtcatcagaaacaag
atccgtgccatcggcaaaatggccaaaatgttctcagtcctgcgagaggagagtgagaat
gtgttaaccctgaaaggtctgacccccaccggcatgctgccgagcggcgtactgtctgga
ggaaaacagaccttgcagagcgctaccatcgaggccattgaagctgtggagacggatgag
gatggagaagccatccgtggcttttcgccacagcacaagatcaccagtttcgaggaagcg
aagggtctggaccgcataaacgagcgcatgccgcctcgccgagacgtggtcaacagcgtg
gggctgtcgatgggcaagatgaacatggccgaatccaacggcacggatgacaacagcaat
atccagtga

DBGET integrated database retrieval system