KEGG   Sinocyclocheilus rhinocerous: 107706261
Entry
107706261         CDS       T04916                                 

Definition
(RefSeq) catenin beta-1-like
  KO
K02105  catenin beta 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107706261
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107706261
   04520 Adherens junction
    107706261
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107706261
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107706261
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Arm_2 Atx10homo_assoc Queuosine_synth
Other DBs
NCBI-GeneID: 107706261
NCBI-ProteinID: XP_016365416
UniProt: A0A673KH80
LinkDB
Position
Unknown
AA seq 779 aa
MATQSDLMELDMAMEQDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDLDNQ
VLFEWEQGFNQPFTPEPVADLDGQYAMTRAQRVRAAMFPETLDEGMQIISTQFDSSHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLASDDINVVTCAA
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAVCALRHLTSRHQDAEMA
QNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLV
RAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQ
LLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR
MSEDKPQDYKKRLSVELTSSLFRTEPMAWNETGDLGLDIGAQGEPLGYRPDDPSYRSFHS
GYGQDGLGMDGMLEHEMGGHHPGTEYPVEGLPDLGHAQDLMDGLPPTDSNQLAWFDTDL
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggctacccagtctgaccttatggagcttgatatggccatggagcaggatcgtaaagcc
gctgtgagtcactggcagcagcagtcctacctggattcaggtattcactctggggccacc
accacagcgccgtctctgtcaggcaaaggcaaccctgaggaggaggatctggacaaccag
gtgctctttgagtgggagcagggcttcaaccagcccttcacacctgagccggtggcagac
ctggatgggcagtatgccatgacccgtgcacagcgtgtccgtgctgccatgtttccggag
actctcgatgagggcatgcagattatttctacccagtttgactcctcccaccccaccaat
gtgcagcggctggccgagccttcccaaatgctcaaacatgccgttgtcaatctcattaac
taccaggatgatgctgaactggccaccagagcaatccctgagctcaccaaacttctcaac
gatgaggaccaggtggtggtgaacaaagccgcagtgatggtgcaccagctctccaagaaa
gaggcctctcgccacgccatcatgcgctctccccagatggtgtcggcaatcgtgaggacc
atgcagaacaccaatgatgtagagactgcccgttgtactgccggcaccttacacaacctg
tcccatcacagagagggcctcctcgctatctttaagtcaggaggaattcctgccctcgtc
aagatgctcgggtcccccgttgatagtgtgctgttctatgccatcaccacccttcacaac
ctcctgcttcatcaggaaggtgctaaaatggctgtccgtcttgctggaggacttcagaag
atggtggccctgctcaacaaaaccaatgtcaaattccttgccatcaccacagactgctta
cagatcctggcatacggcaaccaggagagcaagttgatcatcctggccagtggaggacct
caagctctggtcaacatcatgagaacatacacctatgagaaactgctctggaccacaagt
cgtgtgctaaaggtgttgtctgtctgctccagcaacaaacccgccattgttgaggctggt
ggtatgcaagctcttggtcttcacttgacagatcccagtcagcgtctggttcaaaactgc
ctgtggactctcagaaacttgtcagatgctgccaccaagcaggaagggatggaaggactt
cttggcactctggttcagcttcttgcttcagatgacatcaatgtggtcacctgcgctgct
ggcatactatctaacctcacgtgtaacaactacaagaacaagatgatggtttgccaagtg
ggtggaatcgaggccctggtccgtactgttctcagagctggtgacagagaggacatcacc
gaacctgctgtttgtgcgctacgccatctaacatccagacaccaagatgctgagatggcc
cagaatgcagtgcgtcttcattacggcctgcctgtagtggtcaaactgctgcacccaccc
tcacactggccgttaattaaggccacagtcgggctgatccgtaatctggcgctatgccca
gccaatcacgcaccactccgagagcagggtgcgattccccggttggtccagttgctggtg
agggcacaccaggacacccaaaggcgcacttcaatgggcggcacacagcaacagtttgtg
gagggagttcgtatggaggagattgtggaaggctgcactggagcacttcacatcctggcc
agagacgtacacaacagaatcgtcatcagggggctcaacactatccccttattcgtacaa
ctgctgtattctcctattgagaacatccagcgggtagcagcaggagttttgtgtgagctg
gctcaagataaggaggcagcagaggccattgaggcagaaggagccacggctcctctcaca
gagctgctgcactccaggaacgagggagtggccacatacgctgcagcagttctgttccgc
atgtctgaggataagcctcaggactacaaaaaacgtctttctgtggaacttaccagctct
cttttcagaacggagcccatggcctggaacgagactggtgacctaggccttgatattggt
gctcagggagagcctcttggatacagaccagatgaccccagctatcgttctttccactct
ggctacggtcaggatggtctgggtatggatggcatgctggagcatgagatgggaggccac
catcctggaacagagtaccccgtagaaggattgcccgacttgggccacgctcaggacctg
atggatggcctgccccctacagactccaatcagctggcctggttcgacacggacctctaa

KEGG   Sinocyclocheilus rhinocerous: 107710337
Entry
107710337         CDS       T04916                                 

Definition
(RefSeq) catenin beta-1-like
  KO
K02105  catenin beta 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107710337
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107710337
   04520 Adherens junction
    107710337
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107710337
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107710337
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 107710337
NCBI-ProteinID: XP_016370572
UniProt: A0A673KDC7
LinkDB
Position
Unknown
AA seq 779 aa
MATQSDLMELDMAMEQDRKVAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDLDNQ
VLYEWEQGFNQPFTPEQVADLDGQYAMTRAQRVRAAMFPETLDEGMQVTSTQFDSAHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTSDIETARCTAGTLHNLSHHREGLLAIFKSGGIPALV
KMLGSHVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLASDDINVVTCAA
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAVCALRHLTSRHQDAEMA
QNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLV
RAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQ
LLYSPIENIQRVAAGVLCELAQDKESAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR
MSEDKPQDYKKRLSVELTSSLFRTEPMAWNETGDLGLDIGAPGEPLGYRPDDPSYRSFHS
GYGQDGLGMDGMLEHEMGGHHPGAEYPVEGLPDLGHAQDLMDGLPPTDSNQLAWFDTDL
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggcaacccagtctgaccttatggagcttgatatggccatggagcaggatcgtaaagtt
gctgtcagtcactggcagcagcagtcctacctggattcaggtattcactctggggccacc
acaacagcgccatctctgtcaggcaaaggcaaccctgaagaggaggatctggacaaccag
gtgctgtatgagtgggagcagggcttcaaccagcccttcacacctgagcaggtggcagac
ctggacgggcagtacgccatgacccgtgcacagcgtgtccgtgctgccatgtttcctgag
acactcgatgagggcatgcaggtcacttctacccagtttgactctgcacaccccaccaat
gtgcagaggctggccgagccttctcaaatgctcaaacatgccgttgtcaatctcattaac
taccaggatgatgctgaactggccaccagagccatccctgagctcaccaaacttctcaac
gatgaggaccaggtggtggtgaacaaagccgcagtgatggtgcaccagctgtccaagaaa
gaggcttctcgccacgccatcatgcgctctccccagatggtgtcggccatcgtgaggacc
atgcagaacaccagtgatatagagacggcccgttgtactgccggcaccttacacaacctg
tcccaccacagagagggccttcttgccatctttaagtcaggaggaatccctgccctggtc
aagatgctggggtcccacgttgatagtgtgctgttctatgccatcaccacccttcacaac
ctcctgctccatcaggaaggtgctaaaatggctgttcgtctagctggaggacttcagaag
atggtggccctgctcaacaaaaccaatgtcaaattccttgccatcaccacagactgctta
cagatcctggcatatggcaaccaggagagcaagttgatcatcctggccagtggaggacct
caggctctggtcaacatcatgagaacatacacgtatgagaaactgctctggaccacaagt
cgtgtgcttaaggtgttatctgtctgctccagcaacaaacctgccatcgttgaggctggt
ggcatgcaggctcttggccttcacttgacagatcccagccagcgtctggttcaaaactgc
ctctggactcttagaaacttgtcagatgccgccaccaagcaggaagggatggaaggactt
cttggcactctggttcagcttcttgcttcagatgacatcaatgtggtcacctgcgctgct
ggcatactatctaacctcacgtgtaacaactacaagaacaagatgatggtttgccaagtg
ggtggaattgaggccctggtccgtactgttctcagagctggtgacagagaggacatcacc
gagcctgctgtttgcgcactacgccatctaacatccagacaccaagatgctgagatggcc
cagaatgcagtgcgtctgcactacggcctgcctgtagtggtcaaactgctgcacccaccc
tcacactggccgttaattaaggccacggtcggtctgatccgtaatctggcgctatgccca
gccaatcacgcgccgctccgtgagcagggtgcaattccccggttggtccaattgctggtg
agggcacaccaggacacccagaggcgcacttcaatgggtggcacacagcaacagtttgtg
gagggagttcgtatggaggagatcgtggaaggctgcactggagcacttcacatcctggcc
agagacgtacacaacagaatcgtcatcagggggctcaacaccatccccttattcgtacaa
ctgctgtattctcctattgagaatatccagcgggtagcagcaggagtgttgtgcgagctg
gctcaggataaagagtcagcagaggccattgaggcagaaggagccacggctcctctcaca
gagctgctgcactccaggaacgagggagtggccacatacgctgcagcagtgctgttccgc
atgtccgaggataagcctcaggactacaagaagcgtctttccgtggaacttaccagctct
cttttcagaacggagcccatggcctggaatgagactggtgacttgggccttgatattggt
gctccgggagagcctcttggatacagaccagatgaccccagctatcgttctttccactct
ggctatggccaggatggtctgggcatggatggcatgctggagcatgagatgggaggccac
catcctggagcagagtacccagtagagggactgccagacttgggccacgctcaggaccta
atggatggtctgccccctacagactccaatcagctggcctggtttgacacggacctctaa

KEGG   Sinocyclocheilus rhinocerous: 107748497
Entry
107748497         CDS       T04916                                 

Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107748497
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107748497
   04520 Adherens junction
    107748497
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107748497
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107748497
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 107748497
NCBI-ProteinID: XP_016418777
LinkDB
Position
Unknown
AA seq 780 aa
MATQSDLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEDDDVDNQ
VLYEWEQGFNQSFNQDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSAHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTSGTLHNLSHHREGLLSIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAA
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMA
QNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLV
RAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDIHNRIVIRGLNTIPLFVQ
LLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR
MSEDKPQDYKKRLSVELTSSLFRTEPMAWNETGDLGLDIGAQGEPLGYRQDDPSYRSFHS
GGYGQDAMVMDPMMEHEMGGHHPGPDYPVDGLPDLGHAQDLIDGLPPGDSNQLAWFDTDL
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggctacccaatctgacttgatggagctcgacatggccatggagccggatcgcaaggct
gcggtcagccattggcagcaacagtcttacctggactcaggtatccactctggggccaca
accactgccccatccctaagcggcaagggcaacccagaggatgatgatgtggataatcag
gtgctgtatgagtgggagcagggctttaaccagtccttcaaccaggaccaggtagcagac
atcgatggtcagtatgccatgaccagagcccagagagttcgggcggccatgttcccagag
actctagatgagggcatgcagataccttccacacagtttgactctgcccaccctaccaac
gtccagcgcctggctgagccctcgcagatgctcaaacacgccgtggtcaacctcattaac
taccaggacgatgcagagctggccacccgtgccattccagaactcaccaaactattgaac
gatgaggatcaggtggtggtaaataaggcagctgtgatggtacaccaactctcgaagaag
gaggcctctcgtcacgccatcatgcgatccccacagatggtgtcggccattgtgaggacg
atgcagaacactaatgatgtagaaacagcccgctgcacctccggcaccctgcacaatctt
tcccaccacagagaaggcctgctctccatcttcaaatcaggaggcatccctgccctcgtc
aaaatgcttggttccccagtggactccgtactgttttatgccattacgactctacacaac
ctgctactgcaccaggaaggagccaagatggctgtccgtttggccggaggcctgcagaaa
atggtggccttgttaaacaaaacgaatgtcaaattcctcgctatcacgacagactgcctt
cagattctggcatacggcaatcaggaaagcaaacttatcattctggccagcggaggtcca
caggctctggtcaacatcatgaggacctacacatatgagaaactgttgtggaccaccagt
cgagtgctcaaagtgctgtcagtttgctccagtaacaaacctgccatcgttgaggctggt
ggcatgcaagcacttggccttcacctcacagaccccagtcagcgactggtacagaactgc
ttgtggactttgaggaatctctcagacgccgccaccaaacaggagggcatggaggggctc
ttgggtaccctggtccagttgctcggttcagacgacatcaacgtggtgacgtgtgctgct
ggaatcctgtccaacctcacctgcaacaactacaagaacaagatgatggtatgccaagtg
ggcggcatcgaggcccttgtgcgcactgtacttcgtgccggagacagagaggacatcaca
gagcctgctatctgcgctctgcgtcacctcacatccagacatcaggatgcagagatggcc
cagaatgcagtgcggctgcactatgggctgcctgtggtggtcaaattgctccaccctccc
tcacattggcctctcattaaggccacagtcgggctgatccgtaacctggcactgtgcccc
gccaaccacgccccgctcagagagcagggtgccattccccgcctggtgcagcttctggtc
agggcccatcaggacactcagaggcgtacctccatgggtggaacacagcagcagtttgtg
gaaggtgtgcgtatggaggagatcgtggagggctgcactggagctctgcacattctagca
agagacattcacaacagaatcgtcatcagaggactcaacactattccactgtttgttcag
ttgctgtattctcctattgagaacatccagcgtgtagctgcaggagtgctgtgtgagctg
gctcaggataaggaggcagctgaggccatcgaggcagaaggagccacggctcctctcaca
gagctcctccactccagaaacgagggagtcgccacgtacgctgctgcagttctgttccgc
atgtctgaggataagccccaggactacaagaaacgactgtctgtggagctcaccagctct
ctgttcagaactgagcccatggcctggaacgagactggagatctagggctggacatcggt
gcgcagggagagcctctgggctacaggcaggacgacccaagctaccgctccttccactcc
ggaggttacgggcaggatgccatggtcatggatcccatgatggagcacgagatgggcggg
caccacccgggcccagattaccccgtagatggcctgcccgacctcggccacgcccaggac
ctgatcgacggcctcccgccgggcgacagcaatcagctggcctggttcgataccgatctg
taa

KEGG   Sinocyclocheilus rhinocerous: 107751892
Entry
107751892         CDS       T04916                                 

Definition
(RefSeq) catenin beta-1-like isoform X1
  KO
K02105  catenin beta 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107751892
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107751892
   04520 Adherens junction
    107751892
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107751892
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107751892
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc Queuosine_synth
Other DBs
NCBI-GeneID: 107751892
NCBI-ProteinID: XP_016423151
UniProt: A0A673HYF9
LinkDB
Position
Unknown
AA seq 789 aa
MATQSDLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEDEDVDNQ
MLYEWEQGFNQSFNQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSTHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTSDVETARCTSGTLHNLSHHREGLLSIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRAYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQTSLAEVDVQEGMEGLLGTLVQLLGSD
DINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLT
SRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGA
IPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDIHNRIVIRG
LNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVA
TYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMTWNETGDLGLDIGAQGEPLGYRQD
DPSYRSFHSGGYGQDAMGMDPMMEHEMGGHHPGPDYPVDGLPDLGHAQDLIDGLPPGDSN
QLAWFDTDL
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggctacccaatctgacttgatggagctcgacatggccatggagccggatcgcaaggct
gcagtcagccattggcagcaacagtcttacctggactcaggtatccactctggggccaca
accactgccccatccctgagcggcaagggcaacccagaggatgaggatgtggataatcag
atgctgtatgagtgggagcagggctttaaccagtccttcaaccaggagcaggtagcagac
attgatggtcaatatgccatgaccagagcccagagagtccgggcggccatgtttcctgag
actctagatgagggcatgcagataccttccacacagttcgactctacccaccctaccaat
gtccagcgcctggccgagccctcacagatgctcaagcacgccgtggtcaacctcattaac
taccaggatgatgcagagctggccacccgcgccattccagaactcaccaaactactgaac
gatgaggatcaggtggtggtaaataaggcagctgtgatggtgcaccagctctcaaagaag
gaggcctctcgtcatgccatcatgcgatccccacagatggtgtcagccattgtgaggacc
atgcagaacactagtgatgtagaaacggcacgctgcacctccggcaccctgcacaatctt
tcccaccacagagaaggcctgctctccatcttcaaatcgggaggcattcctgcccttgtc
aaaatgcttggttccccagtggactccgtactgttttatgccattacaactctacacaac
ctcctactgcaccaggaaggagccaagatggctgtccgtctggccggaggcctgcagaaa
atggtagccttgttaaacaaaacaaacgtcaaattcctcgccatcacgacagactgcctt
cagattctggcatacggcaatcaggagagcaaacttatcattctggccagtggaggccca
caggctctggtcaacatcatgagggcctacacatatgagaaacttttgtggaccaccagt
cgagtgctcaaagtgctgtctgtttgctccagtaacaaaccagccatcgttgaggctggt
ggcatgcaagcacttggccttcacctcacagaccccagtcagcgactggtacagaactgc
ttgtggactttgaggaatctctcggatgctgccaccaaacagacgtctttagcagaagta
gatgtgcaggagggtatggaggggctcttgggcaccttggtccagttgcttggttcagat
gatatcaacgtggtaacgtgtgctgctggaatcctgtccaacctcacctgcaacaattac
aagaacaagatgatggtgtgccaagtgggcggcatcgaggcccttgtgcgcactgttctt
cgtgctggagacagagaggacatcacagagcctgctatctgcgctctccgtcacctcaca
tccagacatcaggatgcagagatggcccagaatgcagtgcggctgcactatgggctgccg
gtggtggtcaaattgctccaccctccctcacattggccactcattaaggccacagttggg
cttatccgtaacctggcactgtgtcccgccaaccacgccccgctcagagagcagggtgcc
attccccgcctggtgcagcttctggtcagggcccatcaggacactcagagacgcacctcc
atgggtggaacacagcagcagtttgtggagggtgtgcgtatggaggagattgtggagggc
tgcactggagctctgcacattctagccagagacattcacaacagaattgtcatcagagga
ctcaacactattccactgtttgttcagttgctgtattctcccatcgagaacatccagcgt
gtagctgcaggtgtactgtgtgagctggctcaggataaggaggcagctgaggccatcgag
gcagaaggagccaccgctcctctcacagagctcctccactctagaaacgagggtgttgcc
acgtacgctgctgcagttctgttccgtatgtctgaggataagccccaggactacaagaaa
cgactgtctgtggagctcaccagctctctgttcagaactgagcccatgacctggaacgag
actggagatctagggctggacatcggtgcgcagggagagcctctgggctacagacaggac
gacccaagctaccgctccttccactccggaggttacgggcaggatgccatgggcatggat
cccatgatggagcacgagatgggcgggcaccaccccggcccagattaccccgtagacggc
ctacctgacctcggccacgcccaagacctgatcgacggcctcccgccgggcgacagcaat
cagctggcctggttcgatactgatctgtaa

DBGET integrated database retrieval system