KEGG   Sinocyclocheilus rhinocerous: 107706373
Entry
107706373         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4-like isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107706373
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107706373
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107706373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107706373
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107706373
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 107706373
NCBI-ProteinID: XP_016365554
UniProt: A0A673LTH4
LinkDB
Position
Unknown
AA seq 868 aa
MGAAAGSGWEEGEFEFKLVFEEDPPRQSRCGPEETESGQTHQEPADTHLTSAQAGQPVSI
PPSAGRRAGMHSPPPRRALVREFSGTYESLPARSIQVSESRVLECPSIQITTISPEEDSG
PAGGSYWDGGGGWDRERLYLPLLDSYRDVMTGAGSLSPSPSPASSSSSRGWLSPASSCDS
LLMEEDELNEAAAHFCLSPSSRPTSPGGKKRRNSPLASPSTSRRSSYSEDPSSLPDTGET
SAQSQAPASCELNIPQKTRKTSLEQMSSRDMEPELTLVQTSPCPLPEVAQLRREPPPLGM
DYLSVPPALGWGRTRASAHSPLFRSNALPPLDWPLPSQFDQYELCIEVQPRPHHRAHYET
EGSRGAVKASPGGHPVVKLVGYTERQPLSLQVFAGTADDRSIRPHPFYQIHRVTGKMVGT
ASQESIQAGTKLLDIPLNPENNMTALIDCAGILKLRNSDIELRKGETDVGRKNTRVRLVF
RTHLPLSPPIIPPGRVLALQVASLPIECSQRSAQELPVVESISLTSCSAEGGEELLLGGT
NFLPTSRVFFMERGSDGKVQWEEEAHVDKSNENLLCVQVPAYNDLSLNHPVSVCLYVSNG
KRKRSSTHCFKYLPIMFKEEDLLPSRPSSLPLEGVTLCPMGSGSTVDMRSDLSADDRSMS
FHLPPYPNEYSYSSHGYQEDYWCKPEVTEDGGGRGALTERHPSFESLELGFTELLPPMYP
RASQPLSSSPSPSPWLDSPYLSSSPSPSHSCSLSPFPASSPISTSPLPPLSHSPYPHCPC
PQEMCSSPPSNTSHYQDLCQPPYWQYESWEHQMHPAERDTGPGLKLEGPPDFTGPSPMQH
ITLEEVTEFIGEDIRSFQMGTHMDSRPG
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgggggccgcggcgggctcgggatgggaggagggagagttcgagttcaagctcgtgttc
gaggaggatccgccgcgccagagccgctgcggcccagaagagaccgagagcggccagacg
caccaagagccagccgatacccacttgacttccgcacaggctggccaacccgtgagtatc
ccaccgtcagccggtcgcagggctgggatgcattccccaccccccagacgggcattagtc
agggagttcagtgggacttatgagagtctgccagcaagatcaatacaggtatcagagtct
agagtgcttgagtgccccagcatccagatcaccactatctcccctgaagaggactcaggt
ccagcagggggaagttactgggacggcgggggtggctgggacagggagcgtctatacctg
cccctgctggactcttaccgtgacgtcatgacaggggcaggttccctcagtcccagcccc
agccctgcttccagttcctcatctcgtggatggctgagtccagcttccagctgtgattct
ctcctgatggaggaagacgagctcaatgaagctgctgcccacttctgcctatcgccctcc
tcgcgtcccacgtctcctgggggcaaaaagcgcaggaactccccactggcctcccccagc
acctcccgcagaagcagctactccgaagatccctcctccctcccagacacgggagaaacc
tcggctcagtctcaggctccagcgagctgtgaactcaacatcccacaaaagaccaggaag
acctctctggaacagatgtcatcaagagatatggaaccagagctgaccctcgttcagacc
tctccctgccccctcccagaggttgctcagctgagaagggagcctcccccactagggatg
gactacctgtctgtgcctcctgctctgggctggggcagaaccagggccagcgctcacagt
cctctctttagatctaatgcactgccgccacttgactggccgctgccttcacagtttgac
cagtatgaactgtgcatagaggtacagcccagaccacaccatcgcgctcattatgaaact
gaaggaagtcgaggagcagtaaaggcatcacctggaggccatccagtagtgaagcttgta
ggttatactgagagacagccgctttccttacaggtgtttgcaggaactgctgatgacaga
tcaatacgtcctcatcctttttatcaaatacacagagtaacagggaagatggttggcaca
gctagtcaggagagcatccaggctggcaccaaactcctggacatcccactcaatccagag
aacaacatgactgccctcattgactgtgcaggtattctaaagctgaggaactctgacatt
gaactccggaaaggagagacagatgtagggagaaagaacactcgagtgcgtttggtgttc
cgcacacaccttcctctatctccacccatcatccccccaggacgagtcttagcgctgcag
gtggcgtctttacccattgaatgctcacagcgctctgcacaggagcttcctgtagtggag
tctatcagtcttacttcctgttcagcagagggaggcgaggaactacttctaggtgggacc
aactttctacccacctccagagttttctttatggagagaggatcagatggcaaagtccag
tgggaggaagaggcacatgtggacaaaagcaatgagaatttgctatgtgtacaggtgcca
gcctataacgatctttcactgaaccacccagtatctgtctgcctgtacgtgtccaatggg
aagaggaagaggagcagcacacattgctttaaatatctgcccatcatgtttaaagaggaa
gatctgctgccgtcccgtccctctagcttgcccctggaaggagtgacgctttgccccatg
gggagcggcagcactgttgacatgaggtcagacctatccgcagatgacagaagcatgtct
ttccacctgcctccatatcccaatgagtactcttactcctcgcatggctaccaggaggac
tactggtgtaaaccagaggttaccgaggacggtggaggtcgaggtgccctgaccgaaagg
catcccagctttgagagcctggagctgggcttcacggagcttcttcctcccatgtaccca
agagcctcacaacctctttcctcctccccgtctccctctccgtggcttgactctccctat
ctgtcctcctcaccttctccctctcactcttgctctctgagcccattccctgccagcagt
ccgatctcaacctcgccccttcctcctctctctcactccccatatccacactgtccttgc
ccccaagagatgtgttcctcacctccatcaaacactagccactatcaggacctgtgccaa
cctccatactggcaatacgagagctgggagcaccagatgcatcctgctgaaagagacacg
ggccccggtctgaagttggagggacccccggacttcacgggcccttcaccgatgcagcac
atcacactagaggaagtgactgaattcatcggcgaggatataagatcctttcagatgggg
acacacatggacagtcgacctggatga

KEGG   Sinocyclocheilus rhinocerous: 107723991
Entry
107723991         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107723991
   04310 Wnt signaling pathway
    107723991
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107723991
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107723991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107723991
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107723991
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 107723991
NCBI-ProteinID: XP_016388237
LinkDB
Position
Unknown
AA seq 999 aa
MTTNYREELDFRLMFGESSYTQLLGHPESRSDDDATCYPLFPPGPHHPTEQQESCTNPSY
GTPHPGSLQPMESPSRVFDCPSIQITSIPANCHQDLGAHQLDQSAGACGEASAGSLSRDQ
LFLPLDASYRDTSSLCPSPCSSLSSRSWLSDASSCESFSHIYDDVEAELNEAAAQVRLAS
PLVSPLASPLPSPLTSPQASPQVSPLVSPFGSPGCMAAYGDDPWYRYQQHHQQPLQYHCA
QSLSPYQSPRTSITEETWLSPRPHSSSSRPSSRPTSPCGKRRHSSAEVIPGLASPHLSPN
ITPSHSPRESVTEETWMGGATFAPYQTFPLEVDIPSKTRRTYQTNHNQDQVALLPGQEDS
SFQDPGLANPSLNSGITMFLPSLKKEDMVEHFLAVPTHFPWVKPKQVSTPLYRSTSLPPL
DCHLPSQCGQCELKMEIQPKPHHRAHYETEGSRGAIKSDCGRHPVVKLIGYNEKPVSLQM
FIGTADERYTRPHPFYQVHRITGKTVATPSQETVISSTKVLEIPLLPENNMCTSIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRAVFRVHIPQHNGKVLSLQVASMPIECSQRLSQELP
QIESFSPACGSVNGGEEMLITGQNINPESTVVFQEKSSDGKTQWEVDVRALQEKSQNVNT
TSIVVKIPPYYKKTTASSTQVQFYVSNGKRKRSASQFFTYLSAVQVKQEFGLRADLNTNE
LGGQHPTTSPAGLFTTRDPLASDEVQPLEQWLLSEGTVCAPSSTHLSYSPQDPFYLSRSH
PAERSLNAEADLHPMFHPSLVDFNNSFYQKPQQDLSYKEQPSLPMVGGSLQGCKSSQILA
EQPRSQLGKGYQGIPTEHSQNLHNLGPVSVSNTSVLTSPNVDTSGLHTVDPVQFPQAPSS
QVLPLSHQPTLAKVPSNSPSISESLMDPQPLGASLQEPSKSYSMSQDGEHLHIKQEPEEE
KELAFQSIGLQDITLDDVSEIIVRDLFETPDSGSANSLL
NT seq 3000 nt   +upstreamnt  +downstreamnt
atgactactaactacagagaggagctggacttcagactgatgttcggggagagcagttac
actcagctgctgggccacccagaatccagatcggatgatgatgccacctgctaccctctc
tttcctcctgggcctcaccatcccacagaacagcaggagagctgtacaaacccatcttat
ggcacccctcaccctggttccctccagcccatggagtctcccagccgggtatttgactgt
cctagcatccaaatcacctctatcccagccaactgccaccaggacctgggcgcgcaccag
ttggaccagtctgcaggtgcttgtggggaagccagtgctgggtctctatcaagggaccag
ctcttcctgccattggatgcatcgtacagggacacgtcctcactgtgtcccagcccctgc
agtagtttgtcctcccgcagctggttgtctgacgcctcatcctgtgaatccttctcacac
atctacgatgacgtggaggcagaattgaatgaggcagccgctcaagttcggctggcttct
cctctagtgtcgccgctggcgtctcctctgccgtccccacttacttctccccaggcgtct
cctcaagtgtctccgcttgtctctccctttggttctccgggatgtatggctgcatatgga
gatgatccttggtaccgttaccaacaacatcatcagcaacctctacaatatcattgcgcc
caatcgctgtcgccgtatcagtcaccccgcaccagcatcactgaggaaacgtggctcagt
ccccgtccacactcctcatcctcgcggccctcttctcggccaacctcgccatgtggaaaa
aggcgacattccagtgcagaggtcattcccggtttggcatctcctcacctttcccccaac
ataacaccatctcattctcctcgggagagtgtcactgaggagacatggatgggaggcgcc
acatttgctccctaccagacctttccattggaggtagacatcccatccaaaacaagaaga
acgtatcagaccaaccacaaccaggatcaagtggctctgttgcctggacaagaggactca
agttttcaagacccaggtcttgcaaatccatcgctaaactcaggcataaccatgttcctc
cccagtttaaagaaagaggatatggtggaacattttttagccgtcccaacacacttccct
tgggttaaacccaaacaagtcagcactcctttatacaggtccacatctttacctccactg
gactgccatctgcccagtcagtgtggccagtgtgagttaaagatggagatccaacctaaa
cctcaccacagagcccattatgagacggagggcagtcgcggggccattaaatcagactgc
ggaagacaccctgttgttaagctaataggttataatgaaaaacccgtcagcctgcagatg
ttcatcgggacagcggatgagcgttacaccaggccacacccattctatcaagtgcacagg
attactgggaaaaccgtagcgacgccgagtcaagagacagtgatatccagcaccaaagtt
ctcgaaattcctctcctgcctgaaaacaacatgtgtaccagcattgactgtgctgggatc
ctgaagctacggaattcagacatcgagttgcggaaaggagagacggatatcgggcgtaaa
aacacacgtgtgcgtgctgtgttccgtgttcatatccctcaacacaatggaaaagtgctg
tcactgcaggtggcgtccatgcctatagaatgctctcaacgattatctcaggaacttccc
caaatcgagagctttagtcccgcctgtggttctgtgaatggaggagaagagatgcttata
acaggccaaaacatcaatccagagtcaacagttgtcttccaagaaaagagctctgatggt
aaaacacaatgggaggtcgatgtgagggctttacaagaaaagagtcaaaatgtaaacacc
acaagcatagtggtaaagattcctccgtactacaagaaaaccacggcttcctccacccag
gtgcagttctacgttagcaatggcaagaggaagagaagtgcctcacagttcttcacctat
ctttcagcagtgcaggtgaagcaggagtttggcttaagggcggaccttaacaccaatgaa
cttggagggcagcatccgaccacctccccagcaggtctcttcaccaccagagacccgctt
gcgtcagatgaggtccagcctcttgagcagtggctgctgtctgaagggacagtttgtgct
ccatcttccacccatctcagttactcccctcaggatcctttctatctgagccgctctcat
ccagcagaaagaagccttaatgctgaagcagacctccaccctatgttccacccatcattg
gtggatttcaacaactctttctaccaaaagcctcaacaggatctgtcttacaaagaacaa
cctagtcttccaatggttggtggctcactgcaaggctgcaagtcatcccaaatcttagca
gagcaaccaaggtctcaactaggcaaaggataccaaggcatacctacagaacacagtcaa
aatctccacaaccttggtcctgtctctgtgtccaatacatccgtgctaactagcccaaat
gtggatacatccggtctgcacactgtggatcctgtgcaattcccacaggctccgtcttcc
caggtgcttcctctttcccatcagcctactcttgcaaaagtgccttctaactcaccgtcc
atcagcgagagcttgatggaccctcagcctttaggtgcatctcttcaggagcccagcaaa
agttacagtatgtcacaagatggagaacaccttcacattaaacaggaacccgaggaagag
aaagagctagcctttcagtccataggcctgcaggatatcactcttgatgatgtaagtgaa
atcattgtaagagacttgttcgaaactccagattcagggagtgccaacagtctgctataa

KEGG   Sinocyclocheilus rhinocerous: 107738162
Entry
107738162         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4-like isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107738162
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107738162
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107738162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107738162
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107738162
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG Viral_RdRp_C
Other DBs
NCBI-GeneID: 107738162
NCBI-ProteinID: XP_016405358
LinkDB
Position
Unknown
AA seq 870 aa
MGAAPGSGWEEGEFEFKLVFEEDPPRQSRCGPEDTDSGQTHREPADTHLTSALAGQPVSI
PPPAGRRAGMHSPPPRRAFVREFSGTYESLPARSIQVSESRVLECPSIQITTISPEDDSG
PAGGSYWDGGGGWDRERLYLPLLDSYRDVMTGAGSLSPSPSPASSSSSRGWLSPASSCDS
LLVEEDELNEAAAHFCLSPSSRPTSPGGKKRRNSPLASPSTSRRSSYSEDLSSLPDTGET
SAQSQAPANCELNIPQKTRKTSLEQMSSRDIEPELTPIQTSPCPLPEVAQLRREPPTIGM
DYLSVPPALGWGRTRASAHSPLFRSNALPPLDWPLPSQFDQYELRIEVQPRPHHRAHYET
EGSRGAVKASPGGHPVVKLVGYTERQPLSLQVFVGTADDRSIRPHPFYQIHRVTGKMVGT
ASQESIQAGTKLLDIPLNPENSMTALIDCAGILKLRNSDIELRKGETDVGRKNTRVRLVF
RTHLPLSPPIVPPGRVLALQVASLPIECSQRSAQELPVVESISLTSCSTEGGEELLLGGT
NFLPTSRVFFMDRGSDGKVQWEEEAHVDRDKSNENLLCVRVPAYNDLSLNHPVSVCLYVS
NGKRKRSSTHCFKYLPIMFKEEDPLLSRPSILPLEGVTLSPMRSGSTVDMRSDLSADDRS
MSFHLPPYPNEYPYSSHGYQEDYCHKPEVPEDGGGRSALTERHPSFESLELGFTELLPPM
YPRASQPLSPSPSPSPWLDSPYLSSSPSPSHSCSLSPFPASSPISTSPLPPLTHSPYPHC
PCPQEMCSSPPSNTSHYQDLCPPPYFQYESWEHQMRPSERDTDPGLKLEGPPDFSGPTPM
QHITLEEVTEFIGEDIRSFQMGSHMDSRPG
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgggggccgcgccgggctcgggatgggaggagggagagttcgagttcaagcttgtgttc
gaggaggatccgccgcgccagagccgctgcggcccagaagacaccgacagcggccagacg
caccgtgagccagccgatacccacttgacttccgcactggctggccaacccgtgagtatc
ccaccgccagccggtcgcagggctgggatgcattccccaccccccagacgggccttcgtc
agggagttcagtgggacttatgagagtctgccagcaagatcaatacaggtatcagagtct
agagtgcttgagtgccccagcatccagatcaccactatctcccctgaagatgactcaggt
ccagcggggggaagttactgggatggcgggggtggctgggacagggagcgcctatacctg
cccctgctggactcttaccgtgacgtcatgacaggggcaggttccctcagtcccagcccc
agccctgcttccagttcctcatctcgtggatggctgagtccagcttccagctgtgattct
ctcctggtggaggaggatgagctcaacgaagctgctgctcacttctgcctatcgccctcc
tcacgccccacgtctcctgggggcaaaaagcgcaggaactccccactggcctcccccagc
acctcccgcagaagcagctactccgaggatctctcctccctcccggacacgggagaaacc
tcggctcagtctcaggctccagcaaactgtgagctcaacatcccacagaagaccaggaag
acctctctggaacagatgtcatcaagagacatcgaaccagagctgacccccattcagacc
tctccctgccccctcccagaggttgctcagctgagaagggagccccccacaatagggatg
gactacctgtctgtgcctcctgctctgggctggggcagaaccagggccagcgctcacagt
cctctctttagatctaatgcgctgccgccacttgactggccgctgccttcacagtttgac
cagtatgaattgcgcatagaggtacagcccagaccgcaccatcgtgcgcattatgaaact
gaaggaagtcgaggagcagtaaaggcatcacctggaggccatccagtagtgaagctggtg
ggttacactgaaaggcagccgctctccttacaggtgtttgtaggaactgctgatgacaga
tcaatacgtcctcatcctttttatcaaatacacagagtaacagggaagatggtaggcaca
gctagtcaggagagcatccaggctggcactaaactcctggacatcccactcaacccagag
aacagcatgactgccctcattgactgcgcaggtattctaaagctgaggaactctgacatt
gaactccggaaaggagagacagatgtagggagaaagaacactcgagtgcgtttggtgttc
cgcacacaccttcctctgtctccacccatcgtccctccaggacgagtcttagccctgcag
gtggcctctttacccattgaatgctcacagcgctctgcacaggagcttcctgtagtggag
tctatcagtcttacttcctgttcaacagagggaggcgaggaactacttctaggtgggacc
aactttctacccacctccagagttttctttatggatagaggatcagatggcaaagtccag
tgggaggaggaggcacatgtggacagggataaaagcaatgagaatttgctgtgtgtaaga
gtgccagcctataacgatctttcactgaaccacccagtgtctgtctgcctgtacgtgtcc
aatgggaagaggaagaggagcagcacgcactgctttaaatatctgcccatcatgtttaaa
gaagaagatccgctgctgtcccgtccctccatcttgcccctggaaggggtgacgctttcc
cccatgaggagcggcagcactgtcgacatgagatcagacctatccgcagatgacagaagc
atgtctttccacctgcctccatatcccaatgagtacccttactcctcgcatggctaccag
gaggactactgccacaaaccggaggtccccgaggatggtggaggtcgaagtgccctgacc
gaaaggcatcccagctttgagagcctggagctgggcttcacagagcttcttcctcccatg
tacccaagagcctcacaacctctttccccctccccgtctccctctccgtggcttgactct
ccctatctttcctcctcaccttctccctcacactcttgctctctcagcccattccctgca
agcagtcccatctccacctcgccccttcctccactcactcactccccatatccacactgt
ccttgcccccaagagatgtgctcctcgcctccgtcaaacactagccactatcaggacctg
tgcccacctccgtacttccaatatgagagctgggagcaccagatgcgtccctctgaaaga
gacacagaccctggtctgaagctggagggacccccggacttctcgggccccacacccatg
cagcatatcacactagaggaagtgactgaattcattggagaggatataagatcctttcag
atggggtcacacatggatagtcgacctggatga

KEGG   Sinocyclocheilus rhinocerous: 107738181
Entry
107738181         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107738181
   04370 VEGF signaling pathway
    107738181
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107738181
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107738181
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107738181
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107738181
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107738181
NCBI-ProteinID: XP_016405398
LinkDB
Position
Unknown
AA seq 900 aa
MSSFYGDKAAIGLAEELSQVHCQDELEFDYLFEYGTTTELQDEQKLSSYKDLISPPSLSY
PVEEAQAYGIKPCAASFAELNEGFSGYEQLEPKSFLENARPNSQALSPRIEITPSREHYS
HGRDSLQNHLLNTSPSPGLTVPGHDPLAYREPQCLSPASSNSSTSWHSENHSPWASPCVS
PSNSQAAGELCPRLQGIHTGSPRTSPGTSPQSSLAEDCCVGPRSPSPRPGSRSTSPLCKR
TYDMYRNLVPVARSRSPSPHGGHEEHHAPHYGSNNISGVMNGFGVAQASSIPTKIVKTNQ
QAYPLYPENHTDSYLVSCDQEVKTKPGPEPFFVIPQIWPNQLMPGICSIPVASLPPLEWP
LPSRTDQYELHIEVQPKPHHRAHYETEGSRGAVKAPTGGHTVVQLRGYRGKEPLGLEIFI
GTADERILKPHAFYQVHRITGKTVTTTSYEKIISSTKVLEIPLEPKNNMKAIIDCAGILK
LRNADIELRKGETDIGRKNTRVRLVFRVHIPQQGGQHVSLQVASHPIECSQRSAHELPMV
EKQDMDACSVLGGQQMILTGQNFSADSKVIFMEKTHDGQQIWELEATVDKDKSQASMLFI
EVPPYRDPSICHPAKVNFYVINGKRKRSQHQHFTYMPLPVPSIKTEPVDEYESGRMGYSM
SQMLGVSPQPYYNPRGVITPDSGLVPGLVPCQQTRLGVSPPDHRFQQQSPAIMYSRPGKS
LSSSPIYSQTGATMIPDSHRSVLVHTGSPAQSSHLAGQHPSNQHPSIIQFSPTNHHLLRG
GDPPAPPPPEHQHIIYCEGYNQHGPQATGANRSPTPAQAPQQPQNYPTVIQQQPFLQRVT
KDRSPPVQVETQRCSSTDEQRTSVPGRVTVKQENLDQAYLDDVNEIIRKDLTGVPGRGQT
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgagctctttttacggcgataaggctgcgataggactggctgaggagctcagtcaggtg
cactgtcaggatgagctggagtttgactatctttttgaatatggaaccacaacggaactt
caagatgagcaaaaactctcctcgtacaaagacctcatctctcctcccagcctctcctat
cctgtggaggaagctcaagcgtacggcatcaagccgtgtgcggcttccttcgccgaactc
aacgaaggattctctggctatgagcaactggagccaaagagcttcctggagaacgccaga
cccaacagccaagccctgagcccccgaatcgagatcacgccctcccgtgagcactacagc
catggacgagactcgctccagaaccatctcttgaacaccagccccagtcccggtctcacc
gtgcctggtcacgaccctttggcctaccgggagccgcagtgcctgagtcccgccagcagc
aactcatccacctcctggcactcggagaaccactcgccttgggcttccccttgcgtttcg
cccagcaatagccaagcagctggagaactttgccctagactccagggcatccacacgggt
tcccctcgcaccagtccgggcacttctccgcaaagcagcctggccgaggactgctgcgtg
gggccgcgttctccttcgccccggcccggctcgcgatccacctctcctctatgcaaacgc
acctacgacatgtacagaaacctggttccggtggcccgttcgcgcagcccgtcgccccac
ggtggccacgaagagcatcacgccccccattatggctccaataacatctcaggggtgatg
aatgggttcggcgtcgcccaagctagttccattcctaccaaaatcgtgaagaccaaccag
caggcctacccgctttacccagagaaccacactgatagttacctggtgtcatgtgaccag
gaagtgaagaccaaacctggccctgaaccgttcttcgtaatccctcaaatctggcctaat
cagctgatgccgggaatatgcagcatcccagtggcttccttgcccccgctggagtggcct
ctgcccagccgcaccgatcagtacgagctccacatcgaggtgcagcccaaaccacatcac
agggctcactatgagaccgagggcagccgtggggcggtcaaagcccctaccggtggtcac
acggtggtccagttacgtggatacaggggcaaggagccgctgggtttagagatcttcatt
ggcacggcagacgagcgaatcctgaagcctcacgctttctatcaggtccatcgcattacc
ggcaaaaccgtcaccaccaccagctacgagaagatcatcagcagcaccaaagtcctggag
attcctctcgagccaaagaataacatgaaagcaataattgattgcgccgggattctcaag
cttcgcaatgccgacatcgagctgcggaaaggggagacggacatcgggcggaaaaacacg
cgtgttcgactggtattccgtgttcatattccccagcaaggaggccaacatgtgtctctg
caggttgcttcacatcccatcgaatgctcccagaggtctgcccacgagctgcccatggta
gaaaagcaggacatggatgcctgttcggttcttggaggccagcagatgattctcaccggc
cagaacttcagcgcagattcaaaggtgatcttcatggagaagactcacgatggacagcaa
atttgggaattggaagccacagttgacaaagacaaaagccaggcaagcatgctgttcatt
gaagtgcctccgtatagagacccatccatttgccatcctgccaaagtcaacttctatgta
ataaatgggaaacggaagcgcagtcaacatcagcatttcacctacatgcctctaccagtt
ccctctattaagacagagccagtggatgaatatgaatctggtcggatgggttattccatg
tcacaaatgctgggggtgtctccacagccatactataaccctcgcggggtcatcacccca
gacagtggcctggtgcctgggctcgtcccctgtcagcagacccgcctgggtgtctcccct
ccggaccaccgatttcagcagcagagcccagccataatgtactcccgtcctggaaagagc
ttgtcaagcagtcctatttactctcagacgggggccactatgattccagactcccatcga
tcagttctggtccacacgggttccccagcccagtcctctcatctggctggccagcatcct
tccaaccagcatccctcaatcatccagttctctcccaccaaccaccacctgctcagaggt
ggagatcctcctgcgccaccacccccagaacatcaacacatcatttattgtgagggctac
aatcagcatggtcctcaagccacaggggcaaaccgttcaccaacaccagcccaggcacct
cagcagcctcagaattacccaacagtcatccaacaacagcccttcctccagagagtgacc
aaagacaggtcaccacctgtccaagtagagacccagagatgttcctcgacggacgaacag
agaaccagcgttcctggacgagtcacagtcaagcaggagaacttggaccaggcctacctt
gatgatgtgaatgagatcataaggaaggatctgacaggagtgcctggcaggggtcagacc
tag

KEGG   Sinocyclocheilus rhinocerous: 107739553
Entry
107739553         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1-like
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107739553
   04310 Wnt signaling pathway
    107739553
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107739553
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107739553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107739553
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107739553
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107739553
NCBI-ProteinID: XP_016407191
LinkDB
Position
Unknown
AA seq 870 aa
MKSAEEDAYGYSQNNSISLALSNPCPTSQYHNLQTSPSLSISISQPSSFSPQDDMRSVGY
FQTSGTRSNGAPTLESPRIEITAYGQFPEDEVEENSVPVTKRVNSIVTLTLPSIDGYRDP
TCLSPASSVSSRSCHSDASSYESGFSYNYDNSPQNSPWQSPCVSPKGSSSLQSCTLGASP
RHSPSGSPRTSITDDSWMGTRGSRPNSPCGGKRKYSFNGGPSHKYHPYSPNQSPGLSPHT
SPRLSVTEDTWLPNTNQYTNSAIVAAINALTTDGIADHGEGVPLKSRKTSLEHSASMNLK
VEPGGEETGSLELCQEDFSSARLPFKKETYCSGFLDVPQHPYWSKPKPYISPSLPALDWQ
LPSSSGPYSLQIEVQPKSHHRAHYETEGSRGAVKALAGGHPVVQLHGYMESEPLTLQLFI
GTADDRLLRPHAFYQVHRITGKTVSTPSHEVIQSNTKVLEIPLLPESNMRAIIDCAGILK
LRNSDIELRKGETDIGRKNTRVRMVFRVHINQPNGRMVSLQVASNPIECSQRSAQELPLV
DKQSMESCAASGGEQMYLSGHNFQPDSKVVFVERAQDGHHIWEMEAKVNRESSKSVALLV
DVPPYRNQRISSPVQVNFYVCNGKRKRSQYQRFTYLPTNVPTIKTEPHDDYDLPQVCAPL
HPAGLVLHPKPYYSPPAMTPMMPSELRPCVTGSFTSSPQRLAAKPTSLSCSSSPSTSPKL
QDLSPPHLSTKCLSAGSNLGPQSPTVPHVSTIQPTPGRYPQSILYPTGSAASSPGSHPST
PNSAPELPFTPSHSLTQSQATSEASALAAQITKGPVRSGSSPLLQEEGDTPTMLAVSIKQ
EPQELDQMYLDDVNEIIRNDLSSISVHSHA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgaaatccgctgaggaagatgcatatggttacagccaaaacaacagcatctcactagct
ctgagcaacccctgcccaacctcccagtaccacaatcttcagaccagcccttccttgtcg
atatccatcagtcagccatcctcattctcccctcaagatgacatgagatcagtgggttat
ttccaaacatccggcaccaggtccaatggagctcccacattggaaagtccacgcattgag
ataacagcttacgggcagtttcccgaggacgaagtggaggagaacagtgttcccgtgacc
aagcgagtcaattccatagtgacattaactttgccaagcattgacggttatcgtgacccc
acttgcctcagcccggcgagcagcgtgtcttcccgtagctgccattcagatgcatcttcg
tacgaatcaggcttctcgtacaactacgacaactcgccgcagaactcgccctggcagtct
ccctgcgtctccccgaaaggttcctcatctctgcagtcttgcacacttggtgcttctcca
cgccattctccctccggttctccccgtaccagtataaccgacgacagctggatgggcacc
cgaggctcacgaccgaattctccttgtggcggtaaacggaagtacagcttcaacggcggc
ccgtcgcacaagtaccatccgtactcgccgaatcaatccccggggctgtcgccacacact
tcgccccgtctcagcgtgacggaggacacctggctgcccaacaccaatcagtacaccaac
tccgccattgttgccgccattaatgccctcaccacagatggaatagcagatcatggggag
ggggtccctttgaagtcccgcaagaccagtctggagcacagcgcctcgatgaacctgaaa
gtagaaccaggtggagaggagacaggatccctggagctttgccaggaggacttctcctca
gcacgcctgcccttcaaaaaagagacctactgcagcggcttcttggatgtgccccaacac
ccatactggtccaagcccaagccttacatcagtccatcgttgcctgctcttgattggcag
ttgccttccagttcagggccgtacagcctgcagattgaggttcaacccaagtcccatcac
cgtgctcactacgagactgaaggcagcagaggggccgtaaaagcactggcgggagggcat
ccagtggtccagcttcacggctacatggagagtgagcctctgaccctacagctgtttatt
gggacagcagacgaccgtcttctccggccccacgccttctaccaggtccaccgtataacc
gggaagaccgtgtccacaccaagccacgaggtcatacagtccaacaccaaagttcttgag
attcctctattgcctgagagcaacatgagggccataatcgactgcgctggaattctcaag
ctgcgtaactcagacatcgagctccggaagggcgagacagacatcggacggaagaacaca
cgtgtgaggatggtgttccgtgtccacatcaaccaacctaatggcaggatggtgtcctta
caggtggcatctaaccccattgagtgctcccagcgctcagcacaggagttgcccctcgtg
gataaacagagcatggaaagctgtgccgcctcagggggggaacagatgtatctcagtggg
cacaacttccagcccgactccaaggtggtgtttgtggagcgagcacaagatggccatcac
atatgggaaatggaggccaaagtcaacagagaatcatccaaatctgtggctttgcttgtg
gacgtcccaccataccggaatcaaagaatatccagtccagttcaagttaatttctatgtg
tgcaatggcaaacggaagagaagccagtaccagcgtttcacatacctgcccacaaacgtt
ccaaccataaaaacagagccgcacgatgactacgacctcccccaggtttgtgcgccgctc
catcccgccgggttggtgctgcatccgaagccctactacagccccccggcaatgaccccc
atgatgccctcagaactaaggccttgtgtcacgggttcattcacatcgagccctcagaga
ctggcggcaaagcccacctccctgtcctgctcttcctcccccagcaccagccccaaacta
caggatctttccccacctcacctctccactaagtgtctatcagcgggatcgaacctaggc
ccccagtctccaacggtcccacacgtctccaccatccagcccacacccggacgctacccg
cagtccatcctctacccaacaggaagcgccgcatcctctccagggtcccatccttccacc
ccaaactccgcaccagaactccccttcactcccagccacagcctgacccaatcacaggcc
accagcgaggcctctgcgttagcagctcagataaccaaaggaccggtgaggagtgggtcc
tcccccctcctacaggaggagggagacacccccaccatgctggctgtcagcatcaagcag
gaaccacaggaactggatcaaatgtacctagatgatgttaacgaaatcatcaggaacgat
ctctccagcatctcggtgcacagccatgcatag

KEGG   Sinocyclocheilus rhinocerous: 107740285
Entry
107740285         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107740285
   04370 VEGF signaling pathway
    107740285
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107740285
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107740285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107740285
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107740285
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG DUF167
Other DBs
NCBI-GeneID: 107740285
NCBI-ProteinID: XP_016408151
LinkDB
Position
Unknown
AA seq 803 aa
MSNLYENIDGQEELDFPLLFLYNQPDLPPDDQVDDAGIPSSHGTNQTSLYDEESACQLSH
HLPTDDLLTYGQSDYRHPSMLASHPGALQGNGPRIEITCPDLYQHDHVHTNPVNISQPML
DIPYRESQCLSPASSTSSTSWHSDGYSPGTYSPCISPGVGEGTLAGLTEAVLCPMMQAIQ
ASGSPNTSPRTSITEDTVLDRRPTSPRSRSASPQGKRTYAEYETQRSQSPRFGRDEPAEF
YPLANLEDSMNSLSHSLTKPIPTKIVRPNLEYSVYTESHVGMFPPMPEVKKEFTVEPCYF
MPANWSSQALTGVCSMPVAALPAPEWPLPSSTEQYELRIEVQPRQHHRAHYETEGSRGAI
KASTGGHPVVQLRGYTGSEPLALQVFIGTADDRNLRPHAFYQVHRITGKTVSTNSQERML
NGTKVLEVPLEPKENMRAVVDCAGILKLRNADIELKKGETDVGRKNTRVRLVFRVHVPQP
SGQWISLQVASQTIECSQRSAHEQPVVDHHDLDHCLVLGGPQMILRGQNFTSESKVIFFE
KTHVDLQLWEAEAKVYRDKCTSNLLFLEIPPYRDPNIYHPVKVKFHVLNGKKRCSQPQNF
TYTPLSVPQIKAEPVEEYQYAQLGCIGRPIMGISPPSYHLADGCMMPGGPSYQRAHCMYP
AAPQHTPMHSFQTAASILIRFQKHASCVAASHSATSVSTFVPNTYQHTIAGNSIQTTASL
FPTLDVSELCSAAAHQKAYGSRASPTTGRSPPARIHQQTYLPLQHQRNVSPVRVTIKQEN
LDQAYLDDVNAVIRKDLVHKNNL
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgagtaatttatacgaaaacatcgacggtcaagaagaactggactttccattacttttc
ctgtacaaccaacctgacttacctccagatgaccaagttgatgacgctggcatcccctcc
agccatggtaccaatcaaacttctctgtacgatgaggagtctgcgtgccagctttcccac
catctccctaccgatgaccttctcacctatgggcaatctgattatagacacccctccatg
cttgccagccaccctggagcgctccaaggcaacggcccgagaattgagatcacctgccct
gacctgtaccagcatgaccatgtccacaccaaccctgtgaacataagtcagcccatgctt
gacatcccttacagggagagccaatgcctcagtccggctagtagcacatcgtctactagc
tggcattcagatggctattctcctggaacatactccccctgcatctctcccggtgttggt
gaaggaacgctagccggattgaccgaagccgtcctttgcccgatgatgcaggccatccaa
gcttctggttctcccaatacgtcccctcgcaccagcatcacagaagacaccgtcctggac
cgccgtcccacctctccacgttctcgctcggcttctccgcaggggaagcgcacttatgcc
gaatacgagacacagagatctcaaagcccccgttttggccgggacgagcccgccgagttc
tatccactggcaaacttggaggattccatgaacagcctcagccacagcttgactaaacca
atccctactaagattgtccgacctaatctagagtattctgtctacacggaaagccatgtg
ggcatgttcccacctatgccggaagtgaaaaaagaattcactgtggaaccgtgctatttc
atgcctgccaactggtccagtcaggctctcacaggggtttgtagtatgccagtggctgcc
ttgcctgcgcctgaatggcctcttcccagcagcactgagcagtatgagctcaggatagag
gttcaacccagacaacaccaccgggcccactacgagacagagggcagccgaggggccatc
aaagcatctactggaggccatcctgtcgttcagttgcgagggtacaccgggtctgagccg
ctggctctacaggtcttcatcggcacggctgacgacaggaacctcagacctcacgccttc
taccaggtccaccgcatcaccggcaagaccgtctctaccaacagtcaggaacgaatgctg
aacggaaccaaggtcctagaggtgccactggaacccaaggagaacatgagagctgtagtt
gactgcgctggtatcctgaaactgagaaatgccgacattgagctgaagaaaggagagaca
gatgtgggacggaaaaacacacgagtgagattggtcttccgtgtccacgttcctcaaccc
agcggccagtggatctctctccaagtggcttcgcagactattgaatgctctcaaaggtct
gctcacgagcagccagtggtagatcaccatgacttggaccactgtttggttctgggtgga
ccgcagatgatccttaggggccaaaacttcacatcagagtccaaagtcatcttctttgag
aaaacgcatgttgacttacagttatgggaggctgaggcgaaagtttacagagacaaatgc
acatctaacctgctgtttttggaaatccctccatatcgagaccccaacatctaccaccca
gtcaaagtcaaatttcacgtactgaatgggaagaagagatgcagccagcctcaaaacttc
acctacacgcccctctcagtgccacagattaaagcagagccggttgaagaataccaatac
gcacagttaggctgtattgggcgtcctattatgggcatctctcctccctcttaccatctt
gcagacggttgcatgatgccgggtggcccgtcataccagcgagctcactgcatgtaccct
gctgccccacaacacacacccatgcacagcttccaaacggccgcctctatattaatcaga
ttccaaaaacatgcttcgtgcgtggcggcctcacacagcgccacctctgtgtctacattt
gtgccaaacacctaccagcacaccatagcaggtaacagcatccaaacgaccgcctctctg
tttcccaccctcgatgtctcagagctctgctccgctgcggcccatcagaaggcgtatggc
tcgagggcgtccccaaccacagggagatcccctccggcccgtatccatcagcagacatac
ctgccattgcagcaccagagaaacgtcagtcctgtgagagtcaccatcaagcaggagaac
ctggatcaggcctatctggatgatgtgaatgctgttataagaaaggacctcgttcataaa
aataatctctga

KEGG   Sinocyclocheilus rhinocerous: 107740457
Entry
107740457         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107740457
   04310 Wnt signaling pathway
    107740457
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107740457
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107740457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107740457
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107740457
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DUF3304
Other DBs
NCBI-GeneID: 107740457
NCBI-ProteinID: XP_016408393
LinkDB
Position
Unknown
AA seq 1072 aa
MTTANCPGNEELDFRLIFGEDGQQPPLGPADLETDENTSFYVLNVGQPPSVVNQSYGLQR
HGGPAQLLATSPSLQAHHKAYEPSYETQDSKYTPTGVGGGGNGPPKAFECPSIQITSISP
SCQQEMEASEDEMRAKGPDGDYHNRPLSRDHLYLPLDHSYRDSSLSPSPCSSLSSRSWFS
DASSCESISHVYDDVDSELNEAAARFTLGSPLTSPGCSPQTGPHEEVWQQQHHHHHPAFI
HSLSHSHGHSLSPRQSPCHSPRTSITDENWLNPRSPSRPSSRPTSPCGKRRHSSADICYL
GSLSPHHSPTATPGPSPRGSVTEDTWIGSPSMGVSPFQCCPSEADIPSKTRKTSQDCTAA
IQSGKSDLGMDDSGNVSPLLDSPAEDGMHGLKKDGSGEQFLSVPSHFTWNKPKPGHTPIF
RASSLPPLDWPLPNQYGQYELKIEVHPKAHHRAHYETEGSRGAIKATSGGHPIVKLVGYN
EKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIITSTKVLEIPLLPENNMS
ASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVVSLQAASIPVECS
QRSAQELPQVEKASISSCPVSGGEEMVITGSNFFPESKVIFLEKGPDGRPQWEVEAKIIR
EKSQGSSIVVEVPPYHSKTVTSVVQVQFYVCNGKRKRSQSQRFTYIPVRVKQEHRDDLDS
PAVPPMSMPLVHAASLVCAQPLSSPEHSHPPDGLLSSSPRGLAAGLHPPQAPCAPMGSPT
LPHLPHLQAQGLNAPPECQMPFHPGPAATARPSYPPIQHNMPFNGQHSLPMTAGSPQAYE
RIPFQADPAGCHSLGLGMVYGPASSTPTSGVPPGPGSSPSHTACTGSNQVMAHSAPHLHS
LGYHCSAPGQVPSPTHTLGQPAPQLQHPLVYHPAGQRSASCPTPSSAPVHMVPSPHSGPS
SPQLHSLPYHSPTSPSPTSNSPLGPMGLSGQPSPQASSPVLAGLSPAGPLVHPLTQQGER
LNIKQEPEDREPTFRTIGLQDITLDDVNEIIGRDMSQAPEAHGGSPAAHSQS
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgccccgggaatgaagagctggacttcagattgatctttggagaa
gacgggcagcagccgccgctaggccccgcagatctagaaacagatgaaaacacatcattt
tacgtcctcaatgtgggacaacctccttcagtggtgaaccaatcatacggtctccagcgg
catggaggcccagcccaactccttgccacctccccatccctgcaggcccaccacaaggcc
tatgagcccagctacgagacccaggactctaaatacacgcccacaggggtgggcggagga
ggcaatggcccacctaaggcctttgaatgtcccagcatccagatcacctccatctccccg
agctgccagcaggagatggaggccagcgaggatgagatgagagcgaagggtccggatgga
gactaccacaacagacctctgtctcgagaccacctgtacctgcctctagatcactcgtat
cgagattcatccctgagcccgagtccatgtagcagcctttcctctcgtagctggttctcc
gacgcatcgtcctgcgaatccatctcacacgtgtacgatgacgtggattcagagctaaat
gaagcagcggcacgtttcaccctgggctcgcctctcacctcgcctggctgctctccacag
actggaccacatgaggaagtgtggcaacagcagcatcaccatcatcacccggccttcatt
cactccctttctcattcgcatggccattctctctcaccgcgccagtcgccttgccactcg
ccccgtaccagtatcacagatgagaactggctgaaccctcgctcaccctcacggccctct
tcacgtccgacatcgccctgcgggaagagacgccactccagcgctgatatatgctacctg
ggctctttatcgccccatcactccccgactgccactcccggcccctcgcccagggggagc
gtgactgaagacacctggataggaagcccatctatgggtgtatcccctttccagtgttgt
ccctctgaggctgacatcccctccaagacgaggaagacctcccaggactgtacagcagca
atccagtcaggaaagagtgacctgggcatggatgactccgggaatgtgtctcctttgctt
gactcacctgctgaggacggcatgcacggattaaagaaggatggatctggagagcagttt
ctttctgtcccatctcacttcacatggaacaaacccaaaccaggacacacacctattttc
agggcgtcatccctgcctcccctggactggccgttgccgaatcagtatgggcagtatgag
ctaaagatcgaggttcaccccaaagctcatcacagagctcattacgagaccgaaggcagc
cgaggggccatcaaagccacatccgggggacaccctatcgtcaagcttgttggctacaat
gagaagccagtgaacctgcagatgttcatcgggacagcggatgaccgttatttgaggccg
cacgcgttctaccaggttcaccgcataacaggaaaaactgtcgctacggcaagccaggaa
attatcatcaccagcacgaaggttctcgagattcctctccttcctgaaaacaatatgtct
gccagtattgattgtgctggaatcctgaagttgaggaactctgacattgagctgaggaaa
ggagagactgatattggacggaaaaacactcgggtccgtgtggtgttccgggttcacatc
ccacaacccaatggaaaagtggtctcactgcaggctgcttcaattccagtggagtgctcc
cagcgctcagcacaggagttacctcaggtcgagaaggccagcattagcagctgcccagtg
agtggaggagaggaaatggtcatcactggctccaacttcttccctgagtcaaaggtcatt
tttctggagaaaggtcctgatggacgaccgcagtgggaggtggaggcgaagatcatcaga
gagaagagtcaaggatctagcatcgtggtggaggtgcctccttatcacagtaagacggtc
acttcagtggtgcaggtgcagttctatgtgtgcaatggcaaacggaaaaggagccagtca
cagcgctttacctatattcctgtacgggtcaagcaggaacatagggatgatttggactcc
cctgccgtgccgcccatgtccatgcctctggtccatgctgccagtttggtctgtgctcag
ccgctgtcctccccagagcactcccacccaccagacggccttctgtccagctccccacgt
ggcctggctgcaggcctgcaccctccccaggccccctgcgccccaatgggctccccaact
cttccccacctgccccaccttcaggctcaagggctgaatgcacctcctgaatgccagatg
cccttccacccaggccctgctgccactgccaggccgtcttacccacccatacagcacaac
atgcccttcaacggccagcacagtcttcctatgactgcgggctccccacaggcatacgag
cgaatacccttccaggccgacccggctgggtgtcactccctgggtttggggatggtgtat
ggaccggcttcttcgacacccacctctggagtgcctccggggcctggctctagccctagc
cacacagcctgtacaggtagcaaccaggtcatggcccactctgcccctcaccttcactct
ctaggctaccactgctccgctccagggcaggtcccatcacccacccacacattgggacag
ccggccccacagctccagcatcccctggtttaccatccggccgggcagcggtccgcctcc
tgtcccacaccctccagtgctcctgttcatatggtgccatctccccactctgggccctcg
tccccccaactccattccctcccttaccactcacccacctccccgtctcctacatccaac
agccccctggggcccatgggactctctggacagccttctccccaggctagcagccctgtc
ctggctgggttgtcccctgcaggtcccttggtgcacccgttgacccaacagggagagagg
ctgaacatcaaacaggagccagaggatagagagcccaccttccgtaccatcggcctacag
gatattacgcttgatgatgtgaatgagatcataggcagagacatgtctcaggccccagag
gctcatgggggctcgccagctgcacacagtcagtcctag

KEGG   Sinocyclocheilus rhinocerous: 107744362
Entry
107744362         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107744362
   04370 VEGF signaling pathway
    107744362
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107744362
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107744362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107744362
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107744362
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107744362
NCBI-ProteinID: XP_016413449
LinkDB
Position
Unknown
AA seq 814 aa
MSNLYENIDGQEELDFPLLFLYNQPGNDFPPDDQVDDAGIPSSHGTNQTSPIAHQDQSLY
DEESVSQLSYHLPTDELLTYGQSDLRHSFGHSSLLASHAGALQGNGPRIEITCPDLYQHD
HVHTNPVNISRPMLDIPYRESQCLSPASSTSSTSWHSDGYSPCISPGVGEGTLAGLTEAV
LCPMMQAIQASGSPNTSPRTSITEDTVLDRRPTSPRSRSSSPQGKRTYAEYETQRSQSPR
FGRDEPAEFYPLANLEDSMNSFCNSLTKPVPTKIVRPNLEYSVYTESQAGLFPTMTEVKK
EFTMESCYFMPANWSSQALPGVCSMPVAALPALDWPLPSSTEQYELRIEVQPRQHHRAHY
ETEGSRGAVKASAGGHPVVQLRGYTGTEPLALQVFIGTADDRNLRPHAFYQVHRITGKTV
TTSSQERMLNGTKILEVPLEPKESMRAVVDCAGILKLRNADIELKKGETDVGRKNTRVRL
VFRVHVPQPGGQWISLQVSSQSIECSQRSTHEQPAVERQDVDHCSVLGAPQMILRGQNFT
SESKVIFFEKTHVDLQIWEAEAKVYRDKCTSNLLFLEIPPYQDPNIYHPVKVKFHVLNGK
KKCSQPQNFTYTPLSVPQIKAEPVEEYQYAQLDCTGRPIMGVSPPSCHLADGCMMPIGLS
YQRAHCMYPAAPQHTPIRYPLDHMVPGVFAGSPAHASCVAASHSATSVSTFVPNTYQHTI
AGNSIQTTASLFPTLDVSELCSAAAHQKAYGSRASPTTGRSPPARSHQQTYLPVQHQRNV
SPVRVTIKQENLDQAYLDDVNAVIRKDLVHKNNL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgagtaatttatacgaaaatatcgacggtcaagaagaactagactttccattacttttc
ttgtacaaccaacctggtaatgacttccctccagatgaccaagttgacgacgctggcatc
ccctccagccacggtacaaatcagacttccccaatcgcacatcaagaccagtctctgtac
gatgaggagtctgtgtcccagctttcctaccatctccccaccgatgagcttctcacctac
gggcaatccgatctcagacactctttcgggcactcctccttgcttgccagccacgctgga
gcgctccaaggcaacggccccagaattgagatcacctgccctgacctgtaccagcatgac
catgtccacaccaaccctgtgaacatcagtcggcccatgctcgacatcccttacagggag
agccaatgcctcagtccggctagtagcacgtcctctactagctggcattcggatggatac
tccccctgtatctctcccggtgttggtgaaggaacgctagccggattgaccgaagccgtc
ctttgcccgatgatgcaggccatccaagcgtcggggtctcccaacacgtccccgcgcacc
agcatcacagaagacaccgtcctggaccgccgtcccacctctccacgttcccgctcgtct
tctccgcaggggaagcgcacttacgccgaatacgagacacagagatctcaaagcccccgt
tttggccgagacgagcccgccgagttctatcccctggcaaacttggaggattccatgaac
agcttctgcaacagcttgactaaaccagtccctactaagattgtccgacctaatctagag
tattctgtctacacggaaagccaggcgggcctgttcccaactatgacggaagtgaaaaaa
gaattcactatggaatcttgctatttcatgcctgccaactggtccagtcaggctcttcca
ggggtttgtagtatgccagtggctgccttgcctgcgctggactggcctcttcccagcagc
actgagcagtatgagctcaggatagaggttcaacccagacaacaccaccgggcccactac
gagacagagggcagccgaggggccgtcaaagcatctgccggaggccatcctgtcgttcag
ttgcgagggtacaccgggacggagccgctggctctacaggtctttatcggcacggctgac
gacaggaacctcagacctcacgccttctaccaggtccaccgcatcaccggcaagaccgtc
accaccagcagtcaggaacgaatgctgaacggaaccaagatcctagaagtgccactggaa
cccaaggagagcatgagagctgtagttgactgcgctggtatcctgaaactaagaaatgcc
gacattgagctgaagaaaggagagacggatgtgggacggaaaaacacacgagtgagattg
gtcttccgtgtccacgttcctcaacccgggggccagtggatctctctccaagtgtcctcg
caatctattgaatgctctcaaaggtccactcatgagcagccagcagtagagcgtcaggac
gtggaccactgttcggttctgggtgcaccacagatgatccttaggggccagaacttcaca
tcagagtccaaagtgatcttctttgagaaaacacatgttgacttgcagatatgggaggct
gaggcgaaagtttacagagacaaatgcacgtctaacctgctgttcttggaaatccctccg
tatcaagaccccaacatctaccacccagtcaaagtcaaatttcacgtgctgaatgggaag
aagaaatgcagccagcctcaaaacttcacctacacgcccctctcagtgccacagattaaa
gcggagccggttgaagaataccagtatgcacagttagactgtactggccgtcccatcatg
ggcgtctctcctccctcttgccatcttgcggacggttgcatgatgccgatcggcctgtcg
taccagcgtgctcactgcatgtaccctgctgccccacaacacacacccatccgctacccg
ctggatcacatggtgccaggagttttcgccggctccccagctcatgcttcgtgcgtggcg
gcctcacacagcgccacctctgtgtctacatttgtgccaaacacctaccagcacaccata
gcaggtaacagcatccaaacgaccgcctctctgtttcccaccctcgatgtctcagagctc
tgctccgctgcggcccatcagaaggcgtatggctcgagggcatccccaaccacagggaga
tcccctccggcccgcagccatcagcaaacatacctgccagtgcagcaccagagaaacgtc
agtcctgtgagagtcaccatcaagcaggagaacctggatcaggcctatctggatgatgtg
aatgctgttataagaaaggaccttgttcataaaaataatctctga

KEGG   Sinocyclocheilus rhinocerous: 107748694
Entry
107748694         CDS       T04916                                 

Gene name
nfatc1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107748694 (nfatc1)
   04310 Wnt signaling pathway
    107748694 (nfatc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107748694 (nfatc1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107748694 (nfatc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107748694 (nfatc1)
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107748694 (nfatc1)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107748694
NCBI-ProteinID: XP_016419114
UniProt: A0A673M1V4
LinkDB
Position
Unknown
AA seq 870 aa
MKSAEEDAYGYSQNTSISLPLSNPCPPSQYHNLQSSPSLSISISQPSSFSPQDDMSSVVY
FQTSGTRSNGAPTLESPRIEITAYGQFSEDEVEENSVPVAKRVNSIVTLTLPSIDSYRDP
TCLSPASSVSSRSCHSDASSYESGFSYNYDNSPQNSPWQSPCISPKGSSSLQSCTLGASP
RHSPSGSPRTSITDDSWVGTRGSRPNSPCGGKRKYSFNGGPSHKYHPYSPNQSPGLSPQT
SPRLSVTEDTWLPNTNQYTNSAIVAAINALTTDGLTDLGEGIPLKSRKTSLEHSASMNLK
VEPGGEETGSLELCQEDFSSARLPFKKETYCSGFLDVPQHPYWSKPKPYISPSLPALDWQ
LPSSSGPYRLQIDVQPKSHHRAHYETEGSRGAVKALAGGHPVVQLHGYMESEPLTLQLFI
GTADDRLLRPHAFYQVHRITGKTVSTPSHEAIQSNTKVLEIPLLPESNMRAIIDCAGILK
LRNSDIELRKGETDIGRKNTRVRMVFRVHINQPNGRMVSLQVASNPIECSQRSAQELPLV
DKQNMESCAASGGEQMLLSGHNFQHDSKVVFVERAQDGHHIWEMEAKVNRESSKSVALLV
DVPPYRNQRISNPVQVNFYVCNGKRKRSQYQRFTYLPTNVPTIKTEPHDDYDLPQVCVPL
HPAGLALHPKPYYSPPAMTPMMPSELRPCVTGSFTSSPQRLVAKPTSLSCSSSPSTSPKL
QDLSPPHLSSKCLSAGSNLGPQSPTVPHVSTIQPTPGRYPQSILYPTGSAASSPGSHPST
PNSAPELPFTPSHSLTQSQATSEASALAAQITKGPVRSGSSPLLLEERDAPTMLAVSIKQ
EPQELDQMYLDDVNEIIRNDLSSISVHSHA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgaaatccgcagaggaagatgcatacggttacagccaaaacaccagcatctcattacct
ctgagcaacccctgcccaccctcccagtaccacaatctccagtccagcccttccttgtcg
atatccatcagtcagccgtcctcgttctcccctcaagatgacatgagctcagtggtttac
ttccaaacatccggcacccggtccaacggggctcccacgctggagagtccacgcattgag
ataacagcttatgggcagttctccgaggacgaagtggaggagaacagtgttcccgtggcc
aagcgagtcaattccatagtgacattaactttgccaagcattgacagttatcgtgacccc
acctgcctaagcccggcaagcagcgtgtcttcccgtagctgccattcagatgcgtcatcg
tacgaatcaggcttttcgtacaactatgacaactcgccgcagaactcgccctggcagtct
ccttgcatctccccgaaaggttcctcatctctgcagtcctgcaccctcggcgcttctcca
cgccattctccgtctggttctccccgtaccagtatcaccgacgacagctgggtgggcacc
cgaggctcgcgaccgaattccccttgtggcggtaaacggaagtacagcttcaacggtggc
ccatcacacaagtaccatccgtactcaccgaatcaatccccggggctgtcgccacaaact
tcgccccgtcttagcgtgacggaggacacctggctgcccaacaccaaccagtacaccaac
tctgccattgtcgccgccattaatgccctcaccacagatggattaacagatcttggggag
gggatccctttgaagtcccgcaagaccagtctggagcacagcgcctcgatgaacctgaaa
gtagaaccaggtggagaggagacaggatccctggagctttgccaggaggacttctcctca
gcacgcctgcccttcaaaaaagagacctactgcagtggcttcttggatgtgccccaacac
ccatattggtccaagccaaagccttacatcagtccatcgctgcctgctctcgattggcag
ttgccttccagttcagggccgtaccgcctacagattgatgtccaacccaagtcccatcac
cgtgctcactacgagactgaaggcagcagaggggctgtaaaagcactagcgggagggcat
ccagtggtccagcttcatggctacatggagagtgagcctctgaccctacagctgttcatt
gggacagcagacgaccgtcttctccggcctcatgccttctaccaggtccaccgtataacc
gggaagaccgtgtccacaccaagccacgaggccatacagtccaacaccaaagttcttgag
attcctctgctgcccgagagcaacatgagggccataatcgactgcgctggaattctcaag
ctgcgtaactcagacatcgagctccggaagggcgagacagacatcggacggaagaacaca
cgtgtgaggatggtgttccgtgtccacatcaaccaacctaatggcaggatggtgtcctta
caggtggcatctaaccccattgagtgctcccagcgctccgcacaggagctgcccctcgtg
gataaacagaacatggaaagctgtgccgcctcagggggggaacagatgcttctcagcggg
cacaacttccagcatgactccaaggtggtgtttgtggagcgagcacaagatggccaccac
atatgggaaatggaggccaaagtcaacagagaatcatccaaatctgtggctttgcttgtg
gatgtcccaccataccggaaccaaagaatatccaacccagttcaagtgaatttctatgtg
tgcaatggcaaacggaagagaagccagtaccagcgtttcacatacctgcccacaaacgtt
ccaaccataaaaacagagccgcacgacgactatgacctcccccaggtatgtgtgccgctc
catcccgctgggttggcgctgcatccaaagccctactacagccccccggcgatgaccccc
atgatgccctcagaactaaggccttgtgtcacgggctccttcacatccagccctcagaga
ctggtggcaaaacccacctccctgtcctgctcgtcctcccccagcaccagccccaaacta
caggatctttccccgcctcacctctcctctaagtgcctatcagcgggatcgaaccttggc
ccccagtctccaacggtcccacacgtctccaccatccagcccacacccggacgctacccg
cagtccatcctctacccaacaggaagcgccgcatcctctccagggtcccatccttccacc
ccaaactccgcaccagaactccccttcactcccagccacagtctgacccaatcacaagcc
accagcgaggcctctgcgttagcagctcagataaccaaagggccggtgaggagcgggtcc
tcccccctcctactggaggagagagacgcccccaccatgctggctgtcagcatcaagcag
gaaccacaggaactggatcaaatgtacctagatgatgttaacgaaatcatcaggaacgat
ctctccagcatctccgttcacagccacgcatag

KEGG   Sinocyclocheilus rhinocerous: 107752456
Entry
107752456         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107752456
   04310 Wnt signaling pathway
    107752456
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107752456
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107752456
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107752456
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107752456
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG DUF3304
Other DBs
NCBI-GeneID: 107752456
NCBI-ProteinID: XP_016423914
UniProt: A0A673G4K6
LinkDB
Position
Unknown
AA seq 990 aa
MTTNYREELDFRLMFGESSYPSSPGHAESRSDDDANCYPLFPPGPHHSPEQQDSYANQSY
GTPHPGSLQPMESPSRVFDCPSIQITSIPANCHLDLGAHQLDELAGACGEAGAGSLSRDQ
LFLPLDASYRDMSSLCPSPCSSLSSRSWLSDASSCESFSHIYDDVEAELNEAAAQVQLSS
PLVSPLASPLPSPLTSPQASPQVSPLVSPFGSPLAAYGDDPWYRYQQHHQQPLQYHYAQS
LSPYQSPRTSITEETWLSPRPQSSSSRPSSRPTSPCGKRRHSSAEVIPGLASPHLSPNVT
PSHSPRGSVSEETWMGGATFAPYQTPPLEVDIPSKTRRTYQTNHNQHEVALLPEDSSLQD
PGLANPLLNSGIAVSLPSLKKEDIVEYFLAVPTHPWVRPKQVSTPLYRSTSLPPLDSPLP
NQCGQCELKIEIQPKPHHRAHYETEGSRGAIKSDCGRHPVVKLTGYNEKPVSLQMFIGTA
DERYIRPHLFYQVHRITGKTVATPSQETVISCTKVLEIPLLPENNMCASIDCAGILKLRN
SDIELRKGETDIGRKNTRVRAVFRVHIPQHNGKVLSLQVASMPIECSQRLAQELPQIESF
SPACGTVTGGEEMLITGQSINPESTVVFLEKGSDGKTQWEFDVRALQEKSQNTSIVVKIP
PYYKKTTASSTQVQFYVSNGKKKRSASQFFNYLSAQVKQEFGIRTDLNTNDLAGQHPTTS
PAGLTTIGDPVASDEVQPLEQWLLSEGTVCAPSSSHLSYSPQDPLYLSHSHPADRSLNAG
ADLYPMFHPLLVDFSNSLYQKPQQDLSYKGQPSLPVAGGSLQGCKSLQILAEQPRSQLGK
GYQGIPSEHNHNLHNLGPASVSNTPMITSPNVNTSGLHAVDPVQFPHSSSSQVLPLSHQP
TLAKVPFNSPSVRECLMDPQPLGASLQESSKSYNMSQGGERVNIKQKPKEEKELAFRSIG
LQDITLDDVSEIIVRDLFETPDSGNANSVP
NT seq 2973 nt   +upstreamnt  +downstreamnt
atgaccactaactacagagaggagctggacttcagactgatgtttggggagagcagttat
ccgtcttcgccgggccacgcagaatccagatcggatgatgatgccaactgctaccctctc
tttcctcctgggcctcaccattccccagaacagcaggacagctatgcaaaccagtcttat
ggcacccctcaccctggttccctccaacccatggagtctcccagcagggtatttgactgt
cctagcatccaaatcacctctatcccagccaactgccacctggacctgggcgcgcaccag
ttggacgagttggcaggtgcatgtggggaagccggtgctgggtctctatcaagggaccag
ctctttctgccattggatgcatcctacagggacatgtcctcactgtgtcccagcccctgc
agtagtttgtcctcccgcagctggttgtctgacgcctcgtcctgcgaatccttctcacac
atctacgatgacgtggaggcagaactgaatgaggcagccgctcaagttcagctgtcttct
cctctagtgtcgccgctggcgtctcctctgccgtccccactaacttctccccaggcgtct
cctcaagtgtctccgcttgtgtccccctttggttctcctctggctgcatacggagatgac
ccttggtaccgttatcaacaacatcatcagcaacctctacaatatcattacgcccaatcg
ctgtcgccatatcagtcaccccgcaccagcatcactgaggaaacgtggctcagtcctcgt
ccacaatcctcatcctcgcggccttcttctcggccaacctcgccatgtggaaaaaggcga
cattccagtgcagaggtcattcccggtttggcatctccacacctttcccccaacgtaaca
ccgtctcactctcctcgggggagtgtctctgaggagacatggatgggaggtgccacattt
gccccctatcagacccctccactggaggtagacatcccatccaaaacaagaagaacgtat
cagaccaaccacaaccagcatgaagtggctctgttaccagaggactcaagtcttcaagac
ccaggtcttgcaaatccattgctaaactcaggcatagccgtgtccctccccagtttaaag
aaagaggatatagtggaatatttcttagccgtcccaacacacccttgggttagacccaaa
caagtcagcactcctttatacaggtccacatctttaccgccactggactctcctctgccc
aatcagtgtggccagtgtgagttaaaaattgagatccaacctaagcctcaccacagagcc
cattatgagacggagggcagtcgaggggccattaaatcagactgtggaaggcaccccgtt
gtaaagctaacagggtataatgaaaaacccgtcagcctgcagatgttcatcgggacagcg
gatgagcgttacatcaggccacacctattctatcaagtgcacaggattactgggaaaacc
gttgcgacgccgagtcaagagacagtgatatcctgcaccaaagttctcgaaattcctctc
ctgcctgaaaacaatatgtgtgccagcattgactgtgctgggatcctgaagctacggaat
tcagacatcgagctgcggaaaggagagacggatatcgggcgtaaaaacacacgtgtgcgt
gctgtgttccgtgttcatatccctcaacacaatggaaaagtgctgtcactgcaggtggcg
tccatgcctatagaatgctctcaacgattagctcaggaacttccccaaatcgagagcttt
agtcccgcctgtggtactgtgactggaggagaagagatgcttataacaggccaaagcatc
aatccagagtcaacagttgtcttcctagaaaagggctctgatggtaaaacacaatgggag
ttcgatgtgagggctctacaagaaaagagtcaaaatacaagcatagtggtaaagattcct
ccgtactacaagaaaaccacggcttcctccacccaggtgcagttctatgttagcaatggc
aagaagaagagaagtgcctcacagttcttcaactatctttcagcgcaggtcaagcaggag
tttggcataaggacggaccttaacaccaatgaccttgcagggcagcatcctaccacctcc
ccagcaggtctcaccactattggagacccagttgcttcggacgaagtccagcctcttgag
cagtggctgctgtctgaagggacagtctgtgctccatcttcaagccatctcagttactca
cctcaggatcctctgtatctgagccactctcatccagcagacagaagcctcaatgctgga
gcagacctctaccctatgttccaccccttattggtggatttcagcaactctttgtaccaa
aaacctcaacaagatctgtcttacaaaggacaacctagtcttccagtggctggtggttca
ctgcaaggctgcaagtcactccaaatcttagcagagcaaccaaggtctcaactaggcaaa
ggataccaaggcattccttcagaacacaatcataatctccacaaccttgggcctgcctca
gtgtccaatacacccatgataactagcccaaatgtgaatacatctggtctgcatgcagtg
gatccagtgcaattcccacactcctcgtcttcccaggtgcttcctctttcccatcagcct
actcttgccaaagtgccttttaactcaccgtctgtcagagagtgtttgatggaccctcaa
cctttaggtgcatctcttcaggagtccagcaaaagttacaatatgtcacaaggaggtgaa
cgcgtcaacattaaacagaaaccaaaggaagagaaagagctagcctttcggtccataggc
ctacaggatatcactcttgatgatgtaagtgaaatcattgtaagagacttgtttgagact
ccagattcagggaatgccaacagtgtgccgtag

KEGG   Sinocyclocheilus rhinocerous: 107758795
Entry
107758795         CDS       T04916                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107758795
   04370 VEGF signaling pathway
    107758795
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107758795
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107758795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107758795
Transcription factors [BR:srx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107758795
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107758795
NCBI-ProteinID: XP_016432100
LinkDB
Position
Unknown
AA seq 901 aa
MSSFYDDKAALGLAEELDQVHCQDELEFDYLFEYGSTTGLQDEQSISSHKDLISHPSLPY
PVEEAQPYGIKPCAASFAELSAEGLTGYAQLEPKSFLESARPNSQALSPRIEITPSREHY
SHGRDSLQNHLVNISPSPGLTVPGHDPLAYREPQCLSPASSNSSTSWHSENLSPWASPCV
SPSNSQVAGELCPRLQGVHTGSPRTSPGTSPLSSLAEDGCVGPRSPSPRPGSRSTSPLCK
RTYDMYRNLVPVARSRSPSPHGGHEEHHTPHYGSNNISGVMNGFGVAQASFIPTKIVKTN
QQAYSLYPENHTESYLVSCDQDVKTKPGPEPFFVIPQIWPKQLVPGICSIPVASLPLLEW
PLPSRTDQYELHIEVQPKSHHRAHYETEGSRGAVKAPTGGHPVVQLRGYRGKEPLGLQIF
IGTADERILKPHAFYQVHRITGKTVTTTSYEKIISSTKVLEIPLEPKNNMKAIIDCAGIL
KLRNADIELRKGETDIGRKNTRVRLVFRVHVPQQGGQHVSLQVASHPIECSQRSAHELPM
VEKQDMDACSVLGGQQMILTGQNFSADSKVLFMEKTHDGQQIWELEATVDKDKSQASMLF
IEVPPYRDPSICNPAKVNFYVINGKRKRSQPQHFTYTPLPVPSIKTEPVDEYESSRMGYS
MSQMLGVSPQQYYNPRGVITPESSLVPGLVPCQQARLGVSPPDHRFQQQSPAIMYSRPGK
NLSSSPIYSQTGATMIPDSHRSVLVHTGSPAQSAHLAGQHLSNQHPSIIQFSPTNHHLLR
GGDPPTPPPPEHQHIIYCEGYNQHSPQATGANRSPAPAQAPQHPQNYPTVIQQQPFLQRV
AKDRSPPVQVEPQRGSSTEEQRTSVPGRVTVKQENLDQAYLDDVNEIIRKDLTGVPGRGE
T
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgagctctttttacgacgacaaggctgcgttagggctggctgaggagctcgatcaggtg
cactgtcaggatgagctggagtttgactatctttttgagtatggaagcacaacgggactt
caagatgagcaaagcatctcctcgcacaaagacctcatctctcatcccagcctcccctat
cctgtggaggaagctcaaccgtacggcatcaagccgtgtgcggcttccttcgccgaactc
agcgccgaaggtctcacaggctacgctcaactggagcccaagagcttcctggagagcgcc
agacccaacagccaagcgctgagccctcggatcgagatcacaccctccagagagcactat
agtcatggtcgagactcgctccagaaccatctggtgaacatcagccccagtcccggtctc
accgtgcccggtcacgaccctctggcctatagggagccgcagtgcttgagtcccgccagc
agcaactcatccacctcctggcattcggagaacctctcgccctgggcttccccttgcgtt
tcgcccagcaacagccaagtggctggagaactttgccctagactccagggcgtccacacg
ggttcccctcgaaccagtccgggaacttctccgctaagcagcctggccgaggacggctgc
gtggggccgcgctctccttcgccccggcccggctcgcgctccacctcccctctatgcaaa
cgcacctacgacatgtacagaaacctggtgccggtggcccgttcgcgcagcccgtcgccc
catggtggccacgaagagcatcacaccccccattacggctccaataacatctcaggggtc
atgaatgggttcggcgtcgcccaagctagtttcattcctaccaaaatcgtgaagaccaac
cagcaggcctactcgctttacccagagaaccacactgagagttacctggtgtcatgtgac
caggatgtgaagaccaaacctggccctgaaccgttcttcgtaatccctcaaatctggcct
aaacagctggtgccgggaatatgcagcatccctgtggcttccctgccgctgctggagtgg
cctctgcccagccgcaccgatcagtacgagctccacatcgaggtgcagcccaaatcgcac
cacagagctcactatgagaccgagggcagccgcggggcagtcaaagcccctactggaggt
cacccggtggtccagttacgtggataccgaggcaaggagccgctgggattgcagatcttc
attggcacggcagacgagcgcatcctgaagcctcacgctttctatcaggtccatcgcatt
accggcaaaaccgtcaccaccaccagctacgagaagatcatcagcagcaccaaagtcctg
gagattcctctcgagccaaagaataatatgaaagcaataatcgattgcgccgggattctt
aagcttcgtaatgccgacatcgagctgcgaaaaggagagaccgacatcgggcggaaaaac
acacgtgttcggctggttttccgtgttcatgttccccagcaaggaggccaacatgtgtct
ctgcaagttgcttcgcatcccatcgaatgctcccagaggtctgcccacgagctgcccatg
gtagaaaagcaggacatggacgcctgttcggttctcggaggccagcagatgattctcacc
ggccagaacttcagcgcagattcaaaggtgctcttcatggagaagactcatgatggacag
caaatttgggaattggaagccacagttgacaaagacaaaagtcaggcaagcatgctgttc
attgaagtgcctccttatagagacccatccatttgcaatcctgccaaagtcaacttttat
gtaataaatgggaaacggaagcgcagtcaaccgcaacatttcacctacacgcctctacca
gttccgtctattaagacagagccagtggatgaatatgaatctagtcggatgggttattcc
atgtcgcagatgctgggggtgtctccccagcagtactataaccctcgaggggtcatcacc
ccagagagcagcctggttcctggccttgtcccctgtcagcaggcccgcctgggtgtctcc
cctccggaccaccgatttcagcagcagagcccagccataatgtactcccgtcctggaaag
aacttgtcaagcagtcctatttactctcagacgggtgctactatgatcccagactcccat
cgatcagttctggtccacacgggttccccagcccagtctgctcacctggctggccagcat
ctttccaaccagcatccctcaatcatccagttctctcccaccaaccaccacctgctcaga
ggaggagatcctcccacaccaccacccccagaacatcagcacatcatttattgtgagggc
tacaatcagcacagtcctcaagccacaggggcaaaccgttcaccagcaccagcccaggca
cctcagcatcctcagaattaccccacagtcatccaacaacagcccttcctccagagagtg
gccaaagacaggtcacctcccgtccaagttgagccccagagaggttcctcgacggaagaa
cagagaaccagcgttcctggacgagtcacagtcaagcaagagaacttggaccaggcctac
cttgatgatgtgaatgagatcataaggaaggatctgacaggagtgcctggcaggggtgag
acatag

DBGET integrated database retrieval system