KEGG   Sinocyclocheilus rhinocerous: 107707207
Entry
107707207         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 8B isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107707207
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107707207
   04012 ErbB signaling pathway
    107707207
   04310 Wnt signaling pathway
    107707207
   04068 FoxO signaling pathway
    107707207
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107707207
   04137 Mitophagy - animal
    107707207
  09143 Cell growth and death
   04210 Apoptosis
    107707207
   04217 Necroptosis
    107707207
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107707207
   04530 Tight junction
    107707207
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107707207
   04621 NOD-like receptor signaling pathway
    107707207
   04622 RIG-I-like receptor signaling pathway
    107707207
   04625 C-type lectin receptor signaling pathway
    107707207
  09152 Endocrine system
   04910 Insulin signaling pathway
    107707207
   04920 Adipocytokine signaling pathway
    107707207
   04912 GnRH signaling pathway
    107707207
   04914 Progesterone-mediated oocyte maturation
    107707207
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107707207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107707207
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107707207
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107707207
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107707207
NCBI-ProteinID: XP_016366629
UniProt: A0A673HDJ8
LinkDB
Position
Unknown
AA seq 426 aa
MNKNKREKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAFRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQTLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGSDHIDQWNKVIEQ
LGTPSQEFMMKLNQSVRTYVENRPRYTGYSFEKLFPDVLFPADSEHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPLITDKQLDEREHTVEEWKELIYKEV
LDWEERIKNVIRGQPSPIGAAVINGSPQPSSSSSINDVSSMSTEPTVTSDTDSSLEASAG
PLSCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgaacaaaaataagcgagaaaaagaattctacagcgtagatgtgggtgattcaacattc
acagtgttgaagcggtatcagaatctaagacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgaccacaaccttgagcgaaatgtggctataaagaaactcagccggcct
tttcagaatcagactcatgccaaacgcgcattcagagagctggtgctcatgaagtgtgtc
aaccataaaaatataataggcctcttaaatgtttttacaccacaaaaaacattagaagaa
ttccaagatgtttacctagtaatggagctgatggacgccaacctctgccaagtcattcag
atggagctggaccacgagcggctgtcctatttgctgtaccagacgctgtgcggaataaaa
cacctccactcggcggggatcatccacagggatctgaaacccagcaacatcgtggtaaag
tcagactgtaccctgaagatcctggatttcggactggccaggacagcagctacgggtctg
ctgatgacaccatatgtggtgacacgttactacagagcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggatgtatggtctgttggctgtatcatggctgaaatggtcaga
ggtagtgtgttgtttccaggttcagatcatattgatcagtggaacaaagtcatagagcag
ctgggaacaccatcccaggagtttatgatgaaactcaaccagtctgtgcggacctacgtg
gagaacaggccccggtacactggatacagctttgagaagctctttcccgacgtcctgttc
cctgctgattcagaacacaacaaactgaaagcaagccaggcgcgagacctgctgtctaga
atgctggtgatagatgcatccaaacgaatatctgtggatgaagctctgcagcacccctac
attaacgtgtggtacgacccagctgaagtggaagcgccacctcctctaatcacagacaaa
cagctcgatgagagggaacatacagtggaggaatggaaagagctgatctataaagaagtc
ctggattgggaagaacggataaaaaatgtcattcgaggtcagccttcccctataggtgca
gcagtgatcaacggctcaccccagccctcctcctcttcctccatcaatgacgtctcgtcc
atgtccacagagcccaccgtgacctcagacacagacagcagcctggaggcctctgcggga
cccctgagctgctgcagatga

KEGG   Sinocyclocheilus rhinocerous: 107709004
Entry
107709004         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107709004
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107709004
   04012 ErbB signaling pathway
    107709004
   04310 Wnt signaling pathway
    107709004
   04068 FoxO signaling pathway
    107709004
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107709004
   04137 Mitophagy - animal
    107709004
  09143 Cell growth and death
   04210 Apoptosis
    107709004
   04217 Necroptosis
    107709004
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107709004
   04530 Tight junction
    107709004
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107709004
   04621 NOD-like receptor signaling pathway
    107709004
   04622 RIG-I-like receptor signaling pathway
    107709004
   04625 C-type lectin receptor signaling pathway
    107709004
  09152 Endocrine system
   04910 Insulin signaling pathway
    107709004
   04920 Adipocytokine signaling pathway
    107709004
   04912 GnRH signaling pathway
    107709004
   04914 Progesterone-mediated oocyte maturation
    107709004
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107709004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107709004
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107709004
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107709004
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 107709004
NCBI-ProteinID: XP_016368885
LinkDB
Position
Unknown
AA seq 428 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFMLKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARELLSK
MLVIDASKRISVDEALQHPYINVWYDPSEVEAPPPVITDKQLDEREHTVEEWKELIYKEV
QDLEERTKNGVIRGQPASLGAAMSNDSHEPSTSSSSTNDVSSMSTDPTLTSDTDSSQEAP
AGPLGCCR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaacaggaataagcgtgagaaggaatactacagcatagatgtaggagattccacgttc
accgttttgaagcgctatcagaatttaagaccaatcggatctggagcacaaggcatcgtc
tgctcagcgtacgaccatgtccttgaacgaaatgttgcaattaagaaacttagccgaccc
tttcagaaccaaacccacgccaaacgggcctacagagaactggtcctgatgaaatgtgtc
aaccacaaaaatataattggcttgctaaatgtgttcacgcctcagaagacacttgaagaa
ttccaggatgtgtatctggtgatggagctgatggatgctaacctgtgccaggtcattcag
atggagctggaccacgagagactctcatacctgctttatcagatgctctgcggcatcaaa
cacctacatgctgctggcatcatacacagggatctgaaacccagtaacatagtagtgaaa
tcagactgtacgctgaagatcctcgactttggcctggcccggacagccgccaccggcctc
ctcatgactccttacgtggtgacgcgctactaccgtgctcccgaggtcattctgggcatg
ggttaccaagccaatgttgatgtctggtctgttggctgcatcatggctgaaatggtcaga
ggtagtgtgttgtttcctggcacagaccacatcgaccagtggaacaaggtgatcgagcag
ctgggcacaccgtctcaggagttcatgctgaagctcaaccagtccgtgaggacttacgta
gagaaccggccccgctatgctggatacagctttgagaagctcttcccagacgtgctcttc
cctgcagactccgaccacaacaaactgaaagcgagtcaagcgcgagagttgttatccaaa
atgctggtaatagatgcgtctaaacgaatctcggtggacgaggccctccagcacccctac
atcaacgtgtggtacgacccgtcagaagtggaagcgccgccaccggtgatcacggataag
cagctagatgagagagaacacacagtggaagagtggaaagagctgatatataaggaagtg
caggacttggaggaacgaacgaaaaacggggttatccgaggacagccggcctcgctaggt
gcagcaatgagcaatgactcccatgagccctcgacgtcctcgtcctccacaaacgacgtc
tcgtccatgtccaccgaccccacactgacctcggacacagacagcagtcaggaggcgccc
gcaggaccgctgggctgctgcagatga

KEGG   Sinocyclocheilus rhinocerous: 107719076
Entry
107719076         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107719076
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107719076
   04012 ErbB signaling pathway
    107719076
   04310 Wnt signaling pathway
    107719076
   04068 FoxO signaling pathway
    107719076
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107719076
   04137 Mitophagy - animal
    107719076
  09143 Cell growth and death
   04210 Apoptosis
    107719076
   04217 Necroptosis
    107719076
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107719076
   04530 Tight junction
    107719076
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107719076
   04621 NOD-like receptor signaling pathway
    107719076
   04622 RIG-I-like receptor signaling pathway
    107719076
   04625 C-type lectin receptor signaling pathway
    107719076
  09152 Endocrine system
   04910 Insulin signaling pathway
    107719076
   04920 Adipocytokine signaling pathway
    107719076
   04912 GnRH signaling pathway
    107719076
   04914 Progesterone-mediated oocyte maturation
    107719076
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107719076
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107719076
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107719076
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107719076
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107719076
NCBI-ProteinID: XP_016381874
LinkDB
Position
Unknown
AA seq 434 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSK
MLIIDPAKRISVDEALQHPYINVWYDPTEVEAARNQQISMPPPQIYDKQLDEREHSIDEW
KELIYKEVMNFEERTKNGVVKGQPSPSGAAVNSSDSLPPSSSVNDISSMSTDQTLASDTD
SSLETSAGPLGCCR
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccaccttc
acggttctcaaacggtaccaaaatctaaagcccatcggttctggggctcagggaatagtg
tgtgctggatatgacgccgtcttggacagaaatgtggccattaagaaactcagcagacct
tttcagaaccagactcatgccaagagagcatacagggagctggtgcttatgaaatgtgtc
aatcacaaaaacatcatcagcttattaaatgtcttcacaccacagaagtctttagaggaa
ttccaagatgtttacctggtcatggagctgatggatgcaaacctttgccaggtgattcag
atggagctggaccacgagaggatgtcctacctgctgtaccagatgttgtgtggaatcaaa
cacctgcactcagccggcatcatccacagggatctgaaacctagcaatattgtggtgaaa
tccgactgtacgctgaagatcttggactttgggttggcaagaactgctggcactagcttt
atgatgacgccctacgtggtgacgcggtactacagggccccagaggtcatcctgggcatg
ggatacaaggagaacgtggatatttggtcagttggttgcatcatgggagaaatggtgcgc
cacaaaatcctattccccggcagggattacattgaccaatggaataaggttatagagcag
ctcggcacgccctctcctgagttcatgaagaaactgcagccgacggtgcgtaactacgtg
gagaacaggccaaaatacgccggcctgaccttccccaaactcttccctgattgcctcttc
cctgcagactcagagcacaacaaactcaaagctagtcaggccagagacctgctgtctaag
atgttgatcattgatcccgctaagcggatctcagtggacgaggccctgcagcacccctac
atcaacgtgtggtacgacccgaccgaggtggaggcagccaggaatcagcagatatctatg
cctcctccacagatctatgataaacagctagatgagagggaacactcgattgatgaatgg
aaagagctcatctataaagaggtgatgaacttcgaggagagaacaaagaatggtgtggtg
aagggacagccctctccctcaggtgcagccgtgaacagcagcgacagcctccccccctcc
tcctctgtcaacgacatctcctccatgtccaccgaccagaccttggcctctgataccgac
agcagcctggagacctccgccggaccactggggtgctgcaggtga

KEGG   Sinocyclocheilus rhinocerous: 107720002
Entry
107720002         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107720002
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107720002
   04012 ErbB signaling pathway
    107720002
   04310 Wnt signaling pathway
    107720002
   04068 FoxO signaling pathway
    107720002
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107720002
   04137 Mitophagy - animal
    107720002
  09143 Cell growth and death
   04210 Apoptosis
    107720002
   04217 Necroptosis
    107720002
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107720002
   04530 Tight junction
    107720002
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107720002
   04621 NOD-like receptor signaling pathway
    107720002
   04622 RIG-I-like receptor signaling pathway
    107720002
   04625 C-type lectin receptor signaling pathway
    107720002
  09152 Endocrine system
   04910 Insulin signaling pathway
    107720002
   04920 Adipocytokine signaling pathway
    107720002
   04912 GnRH signaling pathway
    107720002
   04914 Progesterone-mediated oocyte maturation
    107720002
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107720002
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107720002
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107720002
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107720002
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107720002
NCBI-ProteinID: XP_016383057
LinkDB
Position
Unknown
AA seq 422 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLHVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFMLKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWFDPSEVEAPPPAITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGVIRGQPASLGAAVSNDSHEPSTSSSSTNDVSSMSTDTDSSQEASAGPLGC
CR
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaacaggaataagcgcgagaaggaatattacagcatagatgtaggagattcaacgttt
accgtgttgaagcgatatcagaatttaagaccaatcggatctggggcgcaaggcatcgtc
tgctcagcgtatgatcatgtcctcgaacgaaatgttgcaattaagaaacttagccgaccc
tttcagaaccaaacccacgccaaacgggcctacagagaactggtgctgatgaaatgtgtc
aaccacaaaaatataattggtttactacatgtgttcacgccacagaagacacttgaagaa
ttccaggatgtgtatctggtgatggagctgatggatgctaacctgtgccaggtcattcag
atggagctggaccacgagagactctcatacctgctttatcagatgctctgcggcattaaa
cacctacacgctgctggcatcatacacagggatctgaagcccagtaacatagtagtgaaa
tccgactgtacgctgaagatcctggacttcggtctggcccggacagccgccaccggcctc
ctcatgactccttacgtggtgacgcgctactaccgggcccctgaggtcattctgggcatg
ggttaccaagccaatgttgatgtctggtctgttggctgcatcatggctgaaatggtcaga
ggtagtgtgttgtttcccggcacagaccacattgaccagtggaacaaggtgatcgagcag
ctgggcacaccgtctcaggagttcatgctgaagctcaaccagtctgtgaggacttacgtg
gagaaccggccccgctatgctggatacagctttgagaagctcttcccagacgtgctgttc
cctgcagactccgaccacaacaaactgaaggcgagccaggcgcgagacttgttatccaaa
atgctggtaatagatgcgtctaaacggatctcggtggacgaggccctccagcacccctac
atcaacgtgtggttcgacccgtcagaagtggaagcgcctccgccggcgatcaccgataaa
cagctggatgagagagaacacacggtggaggagtggaaagagctgatatataaggaagtg
ctggattgggaggaacgaacgaaaaacggggtgatccgaggacagccggcctcactaggt
gcagcagtgagcaatgactcccacgagccctcgacgtcctcgtcctccacaaacgacgtc
tcgtccatgtccaccgacacagacagcagtcaggaggcgagcgcaggaccgctgggctgc
tgcagatga

KEGG   Sinocyclocheilus rhinocerous: 107749009
Entry
107749009         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 10-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107749009
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107749009
   04012 ErbB signaling pathway
    107749009
   04310 Wnt signaling pathway
    107749009
   04068 FoxO signaling pathway
    107749009
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107749009
   04137 Mitophagy - animal
    107749009
  09143 Cell growth and death
   04210 Apoptosis
    107749009
   04217 Necroptosis
    107749009
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107749009
   04530 Tight junction
    107749009
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107749009
   04621 NOD-like receptor signaling pathway
    107749009
   04622 RIG-I-like receptor signaling pathway
    107749009
   04625 C-type lectin receptor signaling pathway
    107749009
  09152 Endocrine system
   04910 Insulin signaling pathway
    107749009
   04920 Adipocytokine signaling pathway
    107749009
   04912 GnRH signaling pathway
    107749009
   04914 Progesterone-mediated oocyte maturation
    107749009
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107749009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107749009
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107749009
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107749009
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107749009
NCBI-ProteinID: XP_016419533
LinkDB
Position
Unknown
AA seq 475 aa
MVFMNRRFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDMWSVGCIFGEVIRGTVLFPGTDHIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGV
VKGQPSPSGAAMNSSESLPPSSSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggtatttatgaacagacgtttcttatataactgcagtgctccagtcctggatgtgaag
attgccttttgtcaggggtttggcaaacaagttgatgtttcttacattgcccagcattac
aacatgagtaaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccacc
ttcacggttctcaaacggtaccaaaatctaaagcccatcggttctggggctcagggaata
gtgtgtgctggatatgatgccgtcctggacagaaatgtggccattaagaaactcagcagg
ccttttcagaaccagactcacgccaagagagcatacagggagctggtgcttatgaaatgt
gtcaatcacaaaaacatcatcagcttattaaatgtcttcacaccacagaagtctttagag
gaattccaagatgtttacctggtcatggagctgatggatgcaaacctttgccaggtgatt
cagatggaactggaccacgagaggatgtcctacctgctgtaccagatgttatgtggaatc
aaacacctgcactcagccggcatcatccacagggatctgaaacctagcaatattgtggtg
aaatccgactgtaccctgaagatcttggactttggcttggcgagaaccgctggcactagc
tttatgatgacgccctacgtggtgacgcggtactacagggccccggaggtcatcctgggt
atgggctacaaggagaacgtggacatgtggtctgtaggctgtatctttggggaagttata
agaggaacagtgctgtttccagggacagatcacatcgaccaatggaataaggttatagag
cagctcggcacgccctctcctgagttcatgaagaaactgcagccgacggtgcgtaactat
gtggagaacaggccaaaatacgccggcctgaccttccccaaactcttccctgattgcctc
ttccctgcagactcggagcacaacaaactcaaagctagtcaggccagagacctgctgtct
aagatgctgatcattgatcccgctaagcggatctcagtggacgaggccctgcagcacccc
tacatcaacgtgtggtacgacccggccgaggtggaggcagccaggaatcagcagatatct
atgcctcctccacagatctatgataaacagctagatgagagggaacactcgattgatgaa
tggaaagagctcatctataaagaggtgatgaacttcgaggagagaacaaagaatggtgtt
gtgaagggacagccctctccctcaggtgcagccatgaacagcagcgagagcctcccccct
tcctcctccgtcaacgacatctcctccatgtccaccgaccagaccctggcctccgatacc
gacagcagcctggagacctccgccggaccgctggggtgctgcaggtga

KEGG   Sinocyclocheilus rhinocerous: 107749917
Entry
107749917         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107749917
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107749917
   04012 ErbB signaling pathway
    107749917
   04310 Wnt signaling pathway
    107749917
   04068 FoxO signaling pathway
    107749917
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107749917
   04137 Mitophagy - animal
    107749917
  09143 Cell growth and death
   04210 Apoptosis
    107749917
   04217 Necroptosis
    107749917
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107749917
   04530 Tight junction
    107749917
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107749917
   04621 NOD-like receptor signaling pathway
    107749917
   04622 RIG-I-like receptor signaling pathway
    107749917
   04625 C-type lectin receptor signaling pathway
    107749917
  09152 Endocrine system
   04910 Insulin signaling pathway
    107749917
   04920 Adipocytokine signaling pathway
    107749917
   04912 GnRH signaling pathway
    107749917
   04914 Progesterone-mediated oocyte maturation
    107749917
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107749917
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107749917
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107749917
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107749917
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107749917
NCBI-ProteinID: XP_016420631
LinkDB
Position
Unknown
AA seq 422 aa
MTEGEGQFYSVQVGDSTFTVLRRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDRIIKTFMICKFVG
TPSLEFMNRLMETVRNYVMNKPQFPGVSFNELFPDWAFPSETEHDQIKTSQARDLLSKML
LIDPESRISVQEALSHPYIHVWYDPAEADTPPPQISDKQLEEREHSIEQWKELIYKEVMD
WEERNENGVLKEECLVDGTVNSSTTASQSSSINDISSMSTEQTLASDTDSSCIDTLTGPL
EE
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaccgagggggaggggcagttctacagcgtgcaggtgggtgactccacctttacggtg
ctcagaaggtaccagcagctccgcgccatcggatccggtgcccagggtatcgtctgctcc
gctctggacactgtacttggcatcccagtcgctgtgaagaaactgagccggccctttcag
aaccagacccatgcgaagagggcttacagagagctggttctgctcaagtgtgttaatcac
aagaatatcatccgtttgcttaatgtcttcacaccccagaagtcattggaagagtttcag
gatttgtacttggtaatggaactgatggacgctagcctttgtcaggtgatccacatggac
ctggaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacatcta
cactcagctggcatcattcacagggatctgaagcccagtaacatcgtagtgaagtctgac
tgcaccttaaagatcctagacttcgggctggccagaaccgcctgcactaacttcatgatg
acgccctacgtagtaaccagatactacagagcaccagaggtcatcttgggcatgaaatat
aaggagaatgttgatatctggtcggtgggttgcatcatgggtgagatggtcaaaggaagt
gtcatattccagggcactgatcgtataattaaaacattcatgatatgtaaatttgtggga
accccctctctggagtttatgaaccgtttgatggagactgtaaggaactatgtgatgaac
aaaccccagtttcctggagtcagttttaacgagctttttcccgattgggccttcccttca
gagactgagcatgaccagatcaaaactagtcaagcacgagacctgctgtccaagatgctt
ttaatcgaccctgaaagccgcatctctgtgcaggaggccctcagtcacccttacatccat
gtgtggtacgacccagccgaggccgatacgcctcctccgcagatatcagacaagcagttg
gaggagcgggaacacagcattgagcagtggaaagagttgatttataaagaagtaatggac
tgggaggagaggaacgagaacggagtgctgaaagaggagtgtttagtagacggtacggtg
aacagcagcaccactgcctcccagtcatcctctattaacgacatctcgtccatgtcgacg
gagcagacattggcctcagacaccgacagctcctgcatcgacaccctcacaggaccgtta
gaggagtga

KEGG   Sinocyclocheilus rhinocerous: 107756804
Entry
107756804         CDS       T04916                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04137  Mitophagy - animal
srx04140  Autophagy - animal
srx04141  Protein processing in endoplasmic reticulum
srx04210  Apoptosis
srx04217  Necroptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04622  RIG-I-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107756804
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107756804
   04012 ErbB signaling pathway
    107756804
   04310 Wnt signaling pathway
    107756804
   04068 FoxO signaling pathway
    107756804
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107756804
   04137 Mitophagy - animal
    107756804
  09143 Cell growth and death
   04210 Apoptosis
    107756804
   04217 Necroptosis
    107756804
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107756804
   04530 Tight junction
    107756804
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107756804
   04621 NOD-like receptor signaling pathway
    107756804
   04622 RIG-I-like receptor signaling pathway
    107756804
   04625 C-type lectin receptor signaling pathway
    107756804
  09152 Endocrine system
   04910 Insulin signaling pathway
    107756804
   04920 Adipocytokine signaling pathway
    107756804
   04912 GnRH signaling pathway
    107756804
   04914 Progesterone-mediated oocyte maturation
    107756804
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107756804
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107756804
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107756804
Protein kinases [BR:srx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107756804
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107756804
NCBI-ProteinID: XP_016429565
LinkDB
Position
Unknown
AA seq 423 aa
MTTEGEGQFYSVQVGDSTFTVLRRFQQLRAIGSGAQGIVCSALDTVLGIQVAVKKLSRPF
QNQTHAKRAYRELVLLKCVNHKNIIRLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHM
DLDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFM
MTPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEIL
GTPSLEFMNRLMETVRNYVLNKPQFPGVSFNELFPDWAFPSETEHDQIKTSQARDLLSKM
LVIDPESRISVQEALNHPYIRVWYDPAEADAPPPQISDKQLEEREHSIEQWKELIYKEVM
DWEERNKNGVLKEECLVDGTVNSSTTASQSFSINDISSMSTEQTLASDTDSSCIDTLTGP
LEE
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaccaccgagggggaggggcagttctacagcgtgcaggtgggtgactccacctttaca
gtgctcagaaggttccagcagctccgcgccattggatccggtgcccagggtatcgtctgc
tccgctctggacaccgtacttggcatccaagtcgctgtgaagaagctgagccggcccttt
cagaaccagacccatgcgaagagggcttacagagagctggttctgctcaagtgtgttaat
cacaagaacatcatccgtttgcttaatgtcttcacaccccagaagtcattggaagagttt
caggatttgtacttggtaatggaactgatggatgctagcctttgtcaggtgatccacatg
gacctggaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacat
ctacactcagctggcatcattcacagggatctgaagcctagtaacatcgtagtgaagtct
gactgcacgctaaagatcttagactttgggctggccagaaccgcctgcactaacttcatg
atgacaccctacgtagtaaccagatactacagggcaccagaggtcatcttgggaatgaaa
tataaggagaatgtggatatctggtcggtgggctgcatcatgggtgagatggtcaaagga
agtgtcatattccagggcactgatcatattgaccagtggaataaagtgattgagattctg
ggaaccccctctttggagtttatgaaccgtttgatggagactgtaaggaactatgtgctg
aacaaaccccagtttcctggagtcagctttaatgagctttttcccgattgggccttccct
tcagagactgagcatgaccagatcaaaactagtcaagcacgagacctgctgtccaagatg
ctggtaatcgaccctgaaagccgcatctctgtgcaggaggccctcaatcacccttacatc
cgtgtgtggtacgacccagccgaggccgatgcgcctcctccgcagatatcagacaagcag
ttggaggagcgggaacacagcattgagcagtggaaagagttgatttataaagaagtaatg
gactgggaggagaggaacaagaacggagtgctgaaagaggagtgtttagtagacggtacg
gtgaacagcagcaccactgcctcccagtcattctctattaacgacatctcgtccatgtcg
acggagcagacattggcctcagacaccgacagctcctgcatcgacaccctcacaggacca
ttagaggagtga

DBGET integrated database retrieval system