KEGG   Sinocyclocheilus rhinocerous: 107707471
Entry
107707471         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107707471
   04340 Hedgehog signaling pathway
    107707471
   04068 FoxO signaling pathway
    107707471
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107707471
   04115 p53 signaling pathway
    107707471
   04218 Cellular senescence
    107707471
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107707471
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C Herp-Cyclin
Other DBs
NCBI-GeneID: 107707471
NCBI-ProteinID: XP_016366976
UniProt: A0A673IG81
LinkDB
Position
Unknown
AA seq 296 aa
MELLCLEMDTIIRALPDPNLLCDDRVLQSLLTIEERFLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIMRKLPLPEDKLDLIRKH
VQTFIALCATDFTFAMYPPSMIATGSVAAAICGLQLNSTNRSLWGDNLTELLAKITNTEV
DVLKECQEQIERVLMNNLREGRRQQQKQQEQGGTRSKALDDQDQSSTPTDVQDINL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaactgctttgtctcgagatggataccattataagagcccttcctgacccgaatctt
ctatgtgatgacagggtactacagagcttgttgaccatcgaagagaggtttcttccccag
tgttcatattttaaatgcgttcagaaagatattcagccctttatgcggaggatggtggca
acttggatgttggaggtctgcgaggaacagaaatgcgaggaagaagtttttccactggct
atgaactacttggaccgatttttagcggtggtaccaacaagaaaatgcaacttgcagttg
cttggcgcagtgtgcatgtttcttgcgtctaaattgaaagagacgcgtccattaactgca
gagaagctgtgcatctacactgataactcaatcagaccgcaggaactgctggaatgggag
ctggttgtcctgggcaaattgaagtggaatctggctgctgtcactcccaatgactttatt
gagcacattatgaggaaacttccgctgcctgaggataagctggacctgatccgtaaacat
gtgcagactttcatcgccctttgtgcaacagatttcactttcgccatgtaccctccatcc
atgattgcaacgggcagcgtggcagcggctatctgtggcctgcagcttaacagcactaac
cgctcactgtggggagacaacctaacagaattactcgccaagatcacaaacacagaagtt
gatgtgttaaaggaatgccaggagcagattgagagagtgttgatgaataacctgagggag
ggtcgccggcaacagcagaaacagcaggaacagggtggcacccgcagcaaagcacttgat
gaccaagaccagtccagcaccccaaccgatgtacaagacatcaacttgtga

KEGG   Sinocyclocheilus rhinocerous: 107710106
Entry
107710106         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107710106
   04340 Hedgehog signaling pathway
    107710106
   04068 FoxO signaling pathway
    107710106
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107710106
   04115 p53 signaling pathway
    107710106
   04218 Cellular senescence
    107710106
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107710106
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107710106
NCBI-ProteinID: XP_016370300
UniProt: A0A673H837
LinkDB
Position
Unknown
AA seq 295 aa
MEFFCLEKDAIMRAQRDPNIFCDERVLQSLLTVEDRYVPQGPYFKCVQKEIQPFMRRMVA
TWMLEVCEEEKCEEDVFPLAMNYLDRFLAAVPTRKCYLQLLGAVCLFLASKLKECQPLSA
RKLCMYTDNSITSQQLLEWELVVLSKLKWNLAAITPLDFIEHILHKLPFPEDRLTLIRKH
AQTFITLCATDHSFTMYPPSMIATGCVGAAVCGLQPDQSNQNLWGDNLTELLAKITHTEV
DCLKSCQEQIEQLLTSSLKESQQQHQQQQEGRASNKGTQSQNLSCTPTDVRDVNL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaatttttttgcttggaaaaggacgcaatcatgcgagctcagagagatcccaacatc
ttctgcgatgaaagagtactgcaaagtcttttaacggtggaggacagatatgttccgcag
ggaccctattttaaatgtgtccagaaggaaattcagccttttatgaggcggatggtcgcg
acgtggatgctggaggtttgtgaagaggagaaatgtgaagaggatgtctttcccttggct
atgaactacctggacagatttttagctgcagttcctacaagaaaatgttatttgcagctc
ttaggggccgtgtgtctcttcctggcttcaaaattaaaagaatgccaaccgctgtcggcc
aggaagctctgcatgtacacagacaactccattacatctcaacaactgctggagtgggag
ttggtggttcttagtaaattgaaatggaacctggctgccatcaccccacttgactttatt
gaacacatcctgcacaaactgccctttcccgaagacagactgacgctgatccgcaaacac
gcgcaaaccttcatcaccctctgtgcaacagatcacagcttcaccatgtaccctccctcc
atgatcgctacaggatgtgtgggggcagcagtatgtggcctccagcctgaccagagcaat
caaaatctgtggggggacaatctgacggagctgctggctaaaatcacccacactgaggtg
gactgtctgaaatcatgtcaagagcagatcgagcagttactgaccagcagcctgaaagaa
agtcaacaacagcatcaacagcaacaggagggcagagccagcaacaaagggacgcaatct
caaaacctgtcctgcacccctacagatgtccgtgatgttaacttatga

KEGG   Sinocyclocheilus rhinocerous: 107723118
Entry
107723118         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107723118
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107723118
   04115 p53 signaling pathway
    107723118
   04218 Cellular senescence
    107723118
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107723118
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107723118
NCBI-ProteinID: XP_016387121
UniProt: A0A673N705
LinkDB
Position
Unknown
AA seq 268 aa
MELFCHELVETDSSSRPVRAFRDAVLTRDSRVCQNLLRSERPSIKPGTESSDEQRYVRPI
LTGWMLQVCEDQKCEEEVFPLAVHYLDRHMSQNAVRRCRLQLLGCVCMFLASKLRESVPL
SAAKLCVYTDHAVTVPEILQWEVLLVSRLDWDLAAVLPSDFLEPLLQTLPLSTEDTASVR
RHVLSYIALSSTELKFSVFAPSAVACSCVTAAVIRLDVLKNEYGPDGLLQLLRDVLDTDM
VSLRSCFSSLEETINRVLPSPPEQDLPL
NT seq 807 nt   +upstreamnt  +downstreamnt
atggagttgttctgtcacgagcttgtcgaaacggactcgagctccagaccggttcgggcg
ttcagagacgcggttctgacccgagactcgcgcgtctgtcagaacctgctgagatcggag
agaccgagcatcaaacccggaaccgagtcgagcgacgagcagcgctacgtgcgcccaatc
ctaacgggatggatgctgcaggtgtgtgaggatcagaagtgtgaggaggaggtgtttcct
ctggccgttcattacctggacaggcacatgtcccagaatgccgtgcgcaggtgccgtctg
cagctgctgggatgcgtctgcatgttcctggcctccaaactcagggaatcggttcctctg
agtgccgccaagctgtgcgtctacaccgaccacgccgtcaccgtcccagagatcctgcag
tgggaggtgctgctggtgtcgcgtctggactgggatctggctgcggttctgccgtctgat
ttcttggagccgctgctgcagacgctgccgctgagcaccgaggacacggcatcggtccgg
agacacgtgctctcctacatcgcgctgagctccacagagctgaagttctcggtcttcgct
ccgtctgcggtggcctgctcgtgtgtgacggcagccgtgatcagactggatgtcctaaag
aacgaatacggccccgacggcctgctgcagctgctgagagacgtcctggacacggacatg
gtgtccctgcgctcctgtttctcgtcgctggaggagaccatcaatcgggtgctgccgtct
ccacccgagcaggacctcccgctctga

KEGG   Sinocyclocheilus rhinocerous: 107725932
Entry
107725932         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107725932
   04340 Hedgehog signaling pathway
    107725932
   04068 FoxO signaling pathway
    107725932
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107725932
   04115 p53 signaling pathway
    107725932
   04218 Cellular senescence
    107725932
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107725932
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107725932
NCBI-ProteinID: XP_016390847
LinkDB
Position
Unknown
AA seq 331 aa
MPKRQQHLRPFCIGTATCSWHCEVVILVSITEKSPNMELFCLEKDSIMRAQRDPNIFCDE
RVLQSLLTVEDRYVPQGPYFKCVQKDIQPFMRRMVATWMLEVCEEEKCEEDVFPLAMNYL
DRFLAAVPTRKCYLQLLGAVCLFLASKLKACQPLSARKLCMYTDNSITSQQLLEWELVVL
SKLKWNLAAITPLDFIEHILHKLPFPEDRLTLIRKHAQTFIALCATDHSFTMYPPSMIAT
GCVGAAVCGLQPDQSNQNLWGDSLTELLAKITHTELDCLKSCQEQIEQLLTNSLKESQQR
HQQQQEGRASNKGTQSQNLSCTPTDVRDVNL
NT seq 996 nt   +upstreamnt  +downstreamnt
atgcctaaaagacaacaacaccttcgtcctttttgcataggcacagccacatgcagctgg
cactgtgaggtggttatattagttagcatcactgagaaaagcccaaacatggaacttttt
tgcttggaaaaggactcaatcatgcgagctcagagagatcccaacatcttttgcgatgaa
agagtattgcaaagtcttttaacagtggaggacagatatgttccgcagggaccctatttt
aaatgtgtccagaaggatattcagccttttatgaggcggatggtcgcgacgtggatgttg
gaggtttgtgaagaggagaaatgtgaagaggatgtctttcccttggctatgaactacctg
gacagatttttagctgcggttcctacaagaaaatgttatctgcagctcttaggggccgtg
tgtctcttcttggcttcaaaattaaaagcatgccaaccgctgtcggccaggaagctctgc
atgtacacagacaactccattacatctcaacaactgctggagtgggagttggtggttctt
agtaaattgaaatggaacctggctgccatcaccccacttgactttatcgaacacatactg
cacaaactgcccttccctgaagacagactgacgctgatccgcaaacacgcgcaaaccttc
atcgccctctgtgcaacagatcacagcttcaccatgtaccctccctccatgatcgccaca
ggatgtgtgggggcagcagtatgtggcctccagcccgaccagagcaaccaaaatctgtgg
ggggacagtctgacggagctgctggctaaaatcacccacactgagctggactgtctgaag
tcatgtcaagagcagatcgagcagttactgaccaacagcctgaaagaaagtcaacaacgg
catcaacagcaacaggagggcagagccagcaacaaagggacgcaatctcaaaacctgtcc
tgcacccctacagatgtccgtgatgtcaacttatga

KEGG   Sinocyclocheilus rhinocerous: 107727103
Entry
107727103         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107727103
   04340 Hedgehog signaling pathway
    107727103
   04371 Apelin signaling pathway
    107727103
   04068 FoxO signaling pathway
    107727103
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107727103
   04115 p53 signaling pathway
    107727103
   04218 Cellular senescence
    107727103
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107727103
   04530 Tight junction
    107727103
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107727103
NCBI-ProteinID: XP_016392367
UniProt: A0A673LWP1
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTSFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDFSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagctgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaactatcttcca
tcaccaaattatttcaagtgtgttcagaaagaaattgtacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgtgaagagcagaaatgcgaagaggaagtttttccgctg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccagattacag
ctgttaggagcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcgctaaataaactgaagtgggatctggcctcagtgacaccacatgatttc
attgaacatttcctcgccaaactgcctatacatcagagctccaagcagatactacgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgtcaacttcatcgcaagccctcca
tccatgatcgcggccggcagcgttgcagcagcagtgcaggggttgtacctcaaaagcagc
gacagttgcctctcgtcccagaacctcaccagcttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacttc
tcttgcactcccacagacgtcagagacattaatatctga

KEGG   Sinocyclocheilus rhinocerous: 107729433
Entry
107729433         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107729433
   04340 Hedgehog signaling pathway
    107729433
   04068 FoxO signaling pathway
    107729433
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107729433
   04115 p53 signaling pathway
    107729433
   04218 Cellular senescence
    107729433
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107729433
SSDB
Motif
Pfam: Cyclin_C Cyclin_N K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107729433
NCBI-ProteinID: XP_016395404
LinkDB
Position
Unknown
AA seq 264 aa
MSVSLWCEEEEGQDRTQSSVRAPWDPSVSGLRVIQRLLQSEERYLPSPLYISLIQREPQR
RGELAKWTMETPSCLAAACVLVASKLTESDTVSADTLCAAAEYDFLSSNLREMERVVLAT
LRWDVAAVTPQDFIPHFLRTLGELRDGDARTGDFLATLRRHGDTLVALCVCDSRFLGSPP
SLVAAAALNSALRGLRAKSAGELSVMTSALATLCQTDVTVLQCCTELIEGALRERLRNGA
HEEKDGDIEEERASTPTDLREIDF
NT seq 795 nt   +upstreamnt  +downstreamnt
atgtctgtgtctctgtggtgtgaggaggaagagggccaggacaggactcagtcttcagtc
cgagccccatgggaccccagcgtctccggactgagagttattcagagacttctgcagtcc
gaggagagatacctgccatctcctctctacatctctctcatccagagagaaccacagcgc
agaggggaactggccaagtggaccatggagactccatcctgtctggctgcagcttgtgtt
ctggtggcctctaaactgacagaaagtgacacagttagtgcagacacgctctgtgcggca
gcagagtatgactttctctcatcaaacctgcgggaaatggagcgtgtggtgctggcgact
ctgcggtgggatgtggcagcagtgactcctcaggacttcatcccgcacttcctgcgcact
cttggggaactcagggacggagacgcgcgtacaggagactttctcgcaacgctgcgacgc
cacggcgatacacttgttgccttgtgtgtgtgtgactcgcgctttctgggaagtcctcct
tcactggtggctgcggctgcactgaactctgccctgcggggtttaagggccaagagtgcg
ggagagctgagcgtcatgacctctgccctggccacactctgtcagactgatgtgacggtg
ctgcagtgctgcactgagctgatagagggagctctcagggagagactgaggaatggagca
catgaggagaaagatggtgatattgaagaggaaagagccagcacacccacagacctaaga
gaaatagacttttaa

KEGG   Sinocyclocheilus rhinocerous: 107730086
Entry
107730086         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107730086
   04340 Hedgehog signaling pathway
    107730086
   04371 Apelin signaling pathway
    107730086
   04068 FoxO signaling pathway
    107730086
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107730086
   04115 p53 signaling pathway
    107730086
   04218 Cellular senescence
    107730086
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107730086
   04530 Tight junction
    107730086
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107730086
NCBI-ProteinID: XP_016396307
UniProt: A0A673FSH7
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIAPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDFSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccataagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaattatcttcca
tcaccaaattatttcaagtgtgttcagaaagaaatcgcacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgtgaagaacagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccaggttacag
ctgttaggagcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcactaaataaactgaagtgggatcttgcctcagtcacaccacatgatttc
attgaacacttcctcgccaaactgcctatacaccagagctccaagcagatactgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgttaacttcatcgcaagccctcca
tccatgatcgcggccggcagcgttgccgcagcagtgcaggggttgtacctgaaaagcagc
gacagttgcctctcatcccagaacctcaccaacttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacttc
tcttgcactcccacagacgtcagagacattaatatctga

KEGG   Sinocyclocheilus rhinocerous: 107732799
Entry
107732799         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107732799
   04340 Hedgehog signaling pathway
    107732799
   04068 FoxO signaling pathway
    107732799
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107732799
   04115 p53 signaling pathway
    107732799
   04218 Cellular senescence
    107732799
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107732799
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C SUIM_assoc Herp-Cyclin
Other DBs
NCBI-GeneID: 107732799
NCBI-ProteinID: XP_016399702
LinkDB
Position
Unknown
AA seq 300 aa
MELLCLEMDTIVRARPDPNLLYDDRVLQSLLTIEERFLPQCSYFKCVQKEIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLSVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIMRKLPLPEDKLDLIRKH
VQTFIALCATDFNFVMHPPSMIATGSVAAAICGLQLNSTNRSLWGDNLTELLAKITNTEV
DLLKACQEQIERVLMNNLREGRRQQQKQQQQQQEQGGPRSKALDDQDQSSTPTDVRDINL
NT seq 903 nt   +upstreamnt  +downstreamnt
atggaactgctttgtctcgagatggacaccattgtaagagcccgtcctgacccgaatctt
ctatatgatgacagggtactacaaagcttgttgaccatcgaagagaggtttcttccccag
tgttcatattttaaatgtgttcagaaagaaattcagccctttatgcggaggatggtggca
acttggatgttggaggtctgcgaggaacagaaatgcgaggaagaagtttttccactggct
atgaactacttggaccgatttttatcggtggtaccaacaagaaaatgtaacttgcagttg
ctcggcgcagtatgcatgtttcttgcgtctaaattgaaagagacgcgtccattaactgca
gagaagctgtgcatctacactgataactcaatcagaccgcaggaactgctggaatgggag
ctggttgttctgggcaaattgaagtggaatctggctgctgtcactcccaatgactttatt
gagcacattatgaggaaacttccgctgcctgaggataaactggacctgatccgtaaacat
gtgcagactttcatcgccctttgtgcaacagatttcaactttgtcatgcaccctccatcc
atgattgcaacgggaagcgtggcagcagctatctgtggcctgcagcttaacagcactaac
cgctcactgtggggagacaacctaacagagttactcgccaagatcacaaacacagaagtt
gatctgttaaaggcatgccaggagcagattgaaagagtgttgatgaataacctgagggag
ggccgccggcagcagcagaaacagcaacagcagcagcaggaacagggtggcccgcgcagc
aaagcacttgatgaccaagaccagtccagcaccccaaccgatgtacgagacatcaacttg
tga

KEGG   Sinocyclocheilus rhinocerous: 107732861
Entry
107732861         CDS       T04916                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
srx04110  Cell cycle
srx04115  p53 signaling pathway
srx04218  Cellular senescence
srx04310  Wnt signaling pathway
srx04340  Hedgehog signaling pathway
srx04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107732861
   04340 Hedgehog signaling pathway
    107732861
   04068 FoxO signaling pathway
    107732861
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107732861
   04115 p53 signaling pathway
    107732861
   04218 Cellular senescence
    107732861
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107732861
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107732861
NCBI-ProteinID: XP_016399767
UniProt: A0A673N7W4
LinkDB
Position
Unknown
AA seq 295 aa
MSVSLWCEEEEGQDRTQSSVRAPWDPSASGLRVIQRLLQSEERYLPSPLYISLIQREPQR
REELAKWTMEVCCECDCDESVFPLAVSLLDRYLSAPLSLPVSPSCLAAACVLVASKLTES
DTVSADALCAAAEYDFLSSNLREMERVVLATLRWDVAAVTPQDFIPHFLRTLGELKDRDV
HTGDFVATLRRHSDTLVAMCVCDSRFLGTPPSLVAAAALNSALRGLRAKSAGELSVMTSA
LATLCQTDVAVLQCCTELIEGALRERLRNGAHEEKDDDIEDERASTPTDLREIDF
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtctgtgtctctgtggtgtgaggaggaagagggccaggacaggactcagtcttcggtc
cgagccccatgggaccccagcgcctccggactgagggttattcagagacttctgcagtca
gaggagagatacctgccatctcctctctacatctctctcatccagagagaaccacagcgc
agagaggaactggccaagtggaccatggaggtgtgctgtgaatgtgactgcgatgagtct
gtatttcccctggctgtctccctgttggatcgatatctgtcggcccctctatccctgcct
gtctctccatcctgtctggctgcagcttgtgttctggtggcctcaaaactgacagaaagt
gacacagttagtgcagatgcactctgtgcggcagcagagtacgactttctctcatcaaac
ctgcgggaaatggagcgtgtggtcctggcgactctgcggtgggatgtggcagcagtgacc
cctcaggactttatcccacacttcctgcgcactctcggggaactcaaggatcgtgacgtg
catacaggagactttgtcgcaacgctgcggcgccacagcgatacacttgttgccatgtgt
gtgtgtgactcgcgctttctgggaacacctccatcactggttgcagcggctgcactgaac
tctgccctgcggggtttaagagccaagagtgcgggagagctgagtgtcatgacctctgcc
ctggccacactctgtcagactgatgtggcggtgctgcagtgctgcactgagctgatagag
ggagctctcagggagagactgaggaacggcgcacacgaggagaaagatgatgatattgaa
gatgaaagagccagcacacccacagacctaagagaaatagacttttaa

DBGET integrated database retrieval system