KEGG   Sinocyclocheilus rhinocerous: 107707484Help
Entry
107707484         CDS       T04916                                 

Definition
(RefSeq) protein-methionine sulfoxide oxidase mical2b-like isoform X1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107707484
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     107707484
Membrane trafficking [BR:srx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    107707484
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    107707484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH FAD_binding_3 LIM Pyr_redox_2 Pyr_redox_3 HI0933_like NAD_binding_7 FAD_binding_2 Pyr_redox DAO NAD_binding_8 FAD_oxidored GIDA
Motif
Other DBs
NCBI-GeneID: 107707484
NCBI-ProteinID: XP_016366996
LinkDB All DBs
Position
Unknown
AA seq 1740 aa AA seqDB search
MGETEDERTSQAGQLFENFVQATTCKGTLQAFSILCRQLELNLSDHRGFYSSLKAAITYW
KAKGLWGKLDKRASHKEYSKGKACTDTRCLIIGGGPCGFRTAIELALLGAKVVVIEKRDT
FSRNNVLHLWPYTIHDLRNLGAKKFYGKFCAGSIDHISIRQLQLMLLKIALIVGVEVHVN
VEFVKLLEPPEGQDTDGPGWRAEVRPADHQISDYEFDVIIGADGRRSTLDGFKRKEFRGK
LAIAITANFVNRNTTAEAKVEEISGVAFIFNQKFFLELKEETGIDLENIVYYKDNTHYFV
MTAKKQSLLDKGVIINDYIETERLLASDNVNQEALLSYAREAADFGTNYQLPSLDYAINH
YSQSDVAMFDFTCMYASENAALVREKNGHQMLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMIKGWAQGKQPLDLLSERESIYRLLPQTTAENISKNFEQYTIDPATRYPNLNSTCVR
PHQVRHLYINGEQGLSSLERSGPTRTSVNISRRESEVRPSRLLLWCQKQTQGYRGVDVTD
LTTSWRSGLALCALIHRQRPDLIDFDSLNEADCAKNNQLAFDVAEREFGIQPVTTGKEMN
AERGPDKLIMVLYLSKFYEMFRNSFLSITGVPKETDANNEDYSSKTTNSLYSSINQALPR
KRIPKVDKKLEDNDNKKRKKASSHLEELMPNQSAPPVGEREEQKENKVRFMATQLLARFE
ENAPSCGVRRQSESETESETDSVADKPVSLDMTENPRFAKPKSQLAPPPPKPKWQPSPYL
RLLESHTRNETHHSDHRLQIQPSHGQKEIQSNHKNTAIHHSLQLTEIPSSYQSSESRPRS
PHIPFKVLQSDSHLPSLMADPSDSLPSFTPALSAMLQCQQKLEEEVSQRKVQAEITRQFD
KKSIKVRAQQLSRLFTGKPLLPQADESSSAVSSSKAFSVQAIPECSTLSCHLSPVPSVQY
KQRSEDSETQLNHVQHTDHSEIRRVECIDPSKQRTVGKVSSAIGVKAATLAILYETDHRP
NNPFTLSLTSMRKEFLQGLGGSDTCHFCMKRVYIMERLSAEGYFFHRECFRCNICGCTLR
LGGHAFDSNQGTFYCKLHFSQRKISSRHLRGEINGVGRPSSSASSDYTATDGLRGPSSGA
ESDSRTQNDPKGLSNPSAPAESAEAQALSDSTEVINMSEVKDSSKKPDPADSAPACPDSP
LQKVKCFTAKGEITNKNNLWRKKIRSTLPLVLIKKFHRGKPDDSTEALTKEDEDSDFEEI
HESLSSTKAATSTTGSDCPLMEDKKSTPMEEIPKIPLYRTHFLPESPKPSTSSPEPVVMA
VPSEANSLSPKNKLMLSLSEKEKLLNWDLAAPGKPSTSEGEQIDRTSTNPPNDQPEPEAP
PKPSRPQPKPTPPLFGFQLWASSLRKSLSSSKGNNPVVLKRNRPLKARPLSEGSFNLSGL
FGSSIRSNQDEEHSNTSTDGSQSRVRTGSELTTLLEQVALGSKTHKGTKDDMASLPPRKL
NFFSSLRIKRSEGADQIKGDNQKDILTILSRFRSKASSQQQQQQESNSSSEEEQDPDSQK
TYSDTSQKKKEKTAIQQTKRDQLKILHRAQVIQRQLEEVEEKQRALEEKGVALEKILRGE
TGDDSTDETTLLQTWFKLVLEKNKLSRYESELMIFAEELELEDTQSRLQQDLRWRMDTDD
CEKSASELAEEQSLLVEIMKVVEKRDKLVSLLEEQRLKEKAEDRDLESMILSRGYQFHWT
NT seq 5223 nt NT seq  +upstreamnt  +downstreamnt
atgggagagacggaggacgagcgtacgtctcaggccggccagctgtttgagaactttgtg
caggccactacctgtaaaggcaccctgcaggccttcagcatcctctgcaggcagctggag
ctgaacctctctgaccacagaggcttctacagcagcctgaaagctgccatcacctactgg
aaggccaaaggcctctgggggaaattggacaagagagccagccacaaggagtacagtaag
ggcaaagcctgcacggacaccagatgtctcatcattggtggcggtccctgcggctttcgg
actgccatagagctggctttgcttggcgccaaggtggtggtgattgaaaagagggacacc
ttctccaggaacaatgtccttcacctttggccttacaccatccatgacctcaggaacctt
ggagccaagaagttctatggaaagttctgtgctggatctatagaccacatcagtattcgt
cagctgcaactcatgttgttaaagattgctctcattgttggggttgaggtgcatgtcaac
gtggagtttgtcaagcttctcgagccgcctgagggccaagacactgatgggcctggatgg
agggcagaggtccggccggccgatcaccaaatctcagactatgagtttgatgtgataatt
ggagcagatggaaggagaagcactcttgatggcttcaagagaaaggagtttagagggaag
ctagcaatcgccatcactgcaaactttgtcaatcgcaacacgacagctgaggccaaagtg
gaggagatcagcggagtggccttcatcttcaatcagaagttcttcttggagctcaaggag
gagaccggcattgatttggaaaacattgtctattacaaggacaacacgcactactttgtc
atgactgcaaagaaacaaagcttgctggacaagggtgtgatcatcaatgactatattgag
accgagcggctgttggcgagcgacaacgtaaaccaagaagctttgctctcatacgcccgt
gaggctgcagattttggcacaaactaccagcttccctctttggattacgccatcaaccac
tacagccagtcagatgtagctatgtttgacttcacctgcatgtacgcctcagagaacgct
gcgcttgtgagggaaaagaacggccatcagatgctggtggcgctggttggagatagtctt
ctagagcctttctggcccatggggacaggatgtgctcgagggtttctggctgcctttgac
acagcgtggatgataaagggttgggctcagggcaaacaaccccttgatcttctgtcagag
agggagagcatctacaggctgctgcctcagacgaccgcagaaaacatctcaaaaaacttt
gagcagtacaccatagacccagccacacgctaccccaacctcaactccacctgcgtacga
ccacatcaggtgcggcatctgtacattaacggcgagcagggcttgagttctctggagcgc
agtggacccacacgcacatccgtaaacatctccagacgagagtcagaggtgcgtcccagc
cggctgctgctgtggtgtcagaagcagacccagggctacaggggggtggatgtgactgac
cttacgacctcctggaggagcggcctggctctgtgcgccctcattcaccgtcagcggccg
gacctcattgattttgactccctgaacgaggcagattgcgctaaaaacaaccagttggca
tttgacgtggcagagagggagtttggaatccagccagtcaccacaggaaaggaaatgaat
gccgaacgggggccagacaagctcattatggtgctctacctctccaaattttacgagatg
ttccgcaactcgtttctatccatcacaggtgtacccaaagagactgatgcaaataatgaa
gactattcatcaaagaccacaaactctctttacagctcgataaatcaagcactgcctcgg
aagagaataccaaaggttgataaaaagttggaagacaatgacaacaaaaagaggaagaag
gccagcagtcatctggaggagttaatgcccaatcagagtgcgccccctgtaggtgagaga
gaggaacagaaggaaaataaggtgcgcttcatggcaactcaactgctggccaggtttgag
gagaacgcaccaagctgtggtgtgcgcagacagtctgaatctgagactgaatctgagact
gactctgttgctgacaaacctgtgtctctggacatgacagaaaacccacggtttgccaaa
cctaagagccagctcgcaccccctccacccaaaccaaaatggcagccttctccttatctt
agactgctggaatctcacacgaggaatgagacccatcattctgaccaccgtttacaaatc
cagcccagtcacggtcaaaaagaaatccagtccaaccacaaaaacactgccattcaccat
agtctccagcttactgaaattccctcaagttatcaaagcagtgagtctcgtcccagatct
cctcacattcccttcaaagtgcttcagtcggattctcatctgccctcattgatggcagac
ccctcagattcactcccatcattcacgccagccctgagcgcaatgttgcagtgccaacag
aagctggaagaggaagttagtcagagaaaagtgcaggctgaaattactagacagttcgac
aaaaagagcattaaagtgcgagctcagcaactgagccgcctgttcactggcaaaccactt
ctacctcaggcagatgaaagctcttctgctgtttcttcttctaaagctttctcagttcag
gctatcccagaatgctctactctctcctgtcatctgtctcctgttccttcagtccaatac
aagcagcgcagtgaagattcagaaacacagctgaaccacgttcagcacacagatcactct
gaaatcagacgtgtagagtgcattgacccctccaaacagagaactgtgggaaaggtttcc
tctgctattggcgttaaagcagctacactggccatcttatatgagaccgatcatagacct
aacaacccttttaccctctcactgaccagcatgcggaaggagtttcttcagggtctgggc
ggcagcgacacctgtcacttctgtatgaagcgcgtgtacataatggagcggctcagtgcg
gagggatacttcttccacagagagtgtttccgctgtaacatctgtggttgcacgttgcgt
ctgggtggacatgccttcgactccaaccaaggcactttttactgcaagctgcacttttct
cagcgaaaaatcagcagtaggcatctaagaggagagatcaatggagttggcagaccctcg
tccagcgctagttctgattacactgccacagacggcctccgcggcccgtcctcaggagcc
gaatcagactccagaactcagaatgacccgaagggtttgtcgaaccccagcgctcctgct
gagagtgcagaggcgcaggccctctcagactcaaccgaggtcataaacatgagtgaagtc
aaagattcatctaaaaagcccgatcctgcagattctgcacctgcgtgtcccgattctcca
ctgcagaaagtgaaatgctttacagccaaaggagaaattacaaacaaaaacaacctctgg
aggaagaaaatccgatccactctgcccctcgtcctgattaagaaatttcaccgtggaaaa
ccagatgatagtactgaagccctcacaaaggaagatgaagactcggactttgaggagatc
catgaatcactctcctcaacaaaggctgcaacatcaactacagggtctgactgcccccta
atggaggacaagaagtcaacacccatggaagagatcccaaaaatccctctatatcgcaca
cattttcttcccgaatccccaaaacccagcacttcctctccagagccagtcgtcatggcc
gttccctcagaagcgaactccctcagccccaagaacaagctcatgctgtctttatctgaa
aaggagaagctgctcaactgggacttggccgctcctggaaagccctcaacttctgaagga
gaacaaattgacagaacctcaacgaatcctccaaatgatcaaccagaaccagaagctcca
ccaaaaccaagccgtcctcaacctaaacccactcctccactctttggcttccaactgtgg
gccagcagtctccggaagtccttatcctccagcaaagggaacaaccctgtggtcctcaag
agaaaccggcctttgaaagccaggccgttgtctgaggggtccttcaacctcagcggcttg
tttggcagcagcattcggagcaaccaggatgaggaacacagcaacacgtctaccgatggc
agtcaatccagagtgaggacaggaagtgagctcaccacgttactggagcaggtggctctc
ggctccaaaacccacaagggcacaaaagatgatatggcctccttaccacccagaaaactc
aatttcttctcctctctgcgcattaagaggagcgaaggagcagatcagatcaaaggagac
aaccagaaggacatcttgaccattctttccaggttcagaagcaaagcttcttctcagcaa
caacaacaacaagagtccaactcatctagtgaagaggaacaggatccagactcacaaaag
acctacagtgacacctcacagaagaaaaaagagaaaacagccatccaacaaaccaagaga
gatcagctgaaaatacttcacagggctcaggtaatccagagacagctggaggaagttgag
gagaagcagagagctttggaggagaaaggtgtggctctggagaagatcctcagaggagaa
actggtgatgactccacagatgagaccacgctactgcaaacctggttcaaactggtcctg
gagaagaacaaactgtcgcgatatgagtctgaactcatgatctttgctgaagaactggag
ttggaggacactcaaagtcggctacagcaagaccttagatggcgaatggacactgacgac
tgtgagaagagtgcgagtgagctggcagaggagcagagcctgctggtggagatcatgaag
gtggtggagaaaagagacaaactggtgagtctgctggaggagcaacggctgaaggaaaaa
gcggaggacagagatctggagagcatgatcctctccagaggctatcagttccactggacc
tga

DBGET integrated database retrieval system