KEGG   Sinocyclocheilus rhinocerous: 107707673
Entry
107707673         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B-like
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107707673
   04350 TGF-beta signaling pathway
    107707673
   04150 mTOR signaling pathway
    107707673
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107707673
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107707673
   04520 Adherens junction
    107707673
   04530 Tight junction
    107707673
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107707673
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107707673
   04625 C-type lectin receptor signaling pathway
    107707673
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107707673
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107707673
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107707673
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107707673
   04031 GTP-binding proteins [BR:srx04031]
    107707673
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107707673
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107707673
  Exosomal proteins of other body fluids (saliva and urine)
   107707673
  Exosomal proteins of colorectal cancer cells
   107707673
  Exosomal proteins of bladder cancer cells
   107707673
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107707673
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA VASP_tetra
Other DBs
NCBI-GeneID: 107707673
NCBI-ProteinID: XP_016367241
UniProt: A0A673LX27
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNKCSLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcgattcgcaagaagctggtgattgtaggagatggagcgtgcggtaaaacctgt
ttgcttatcgtgttcagtaaagaccagtttcctgaagtctatgtccccacggtgtttgag
aactatgtcgccgacattgaggttgacagcaaacaggtggaacttgctctctgggatacc
gcaggacaggaggactacgataggctccgccctctttcgtacccagacactgatgtcatt
cttatgtgcttctctgttgacagtcctgacagtttagagaatattccagagaagtggaca
cctgaggtgaagcacttttgtccaaacgttcccatcatcctcgtcggcaacaaaaaggac
ttgcggaatgatgaacacacacgcagggagctgactaagatgaagcaggagcctgttaag
gcagaggaaggaagagacatggccaatcgaattggtgcatttggttacatggagtgctca
gccaaaacaaaagatggcgttcgggaggtgtttgaaatggccactagagcggcgctgcag
gcacgcaggggaaagaagagcaacaaatgcagtcttctgtga

KEGG   Sinocyclocheilus rhinocerous: 107708160
Entry
107708160         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107708160
   04350 TGF-beta signaling pathway
    107708160
   04150 mTOR signaling pathway
    107708160
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107708160
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107708160
   04520 Adherens junction
    107708160
   04530 Tight junction
    107708160
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107708160
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107708160
   04625 C-type lectin receptor signaling pathway
    107708160
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107708160
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107708160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107708160
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107708160
   04031 GTP-binding proteins [BR:srx04031]
    107708160
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107708160
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107708160
  Exosomal proteins of other body fluids (saliva and urine)
   107708160
  Exosomal proteins of colorectal cancer cells
   107708160
  Exosomal proteins of bladder cancer cells
   107708160
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107708160
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107708160
NCBI-ProteinID: XP_016367810
UniProt: A0A673LUV2
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRSGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagctatcaggaaaaagctggtgatcgtgggagatggagcgtgtgggaagacctgt
ctcctcatagtgttcagcaaagaccagtttccagaagtctatgtgcctactgtgttcgag
aactacattgcagacatcgaagtcgacagcaaacaggtggagctggcattgtgggacaca
gcaggacaggaagactacgatcgtctgaggcctctgtcttacccagacacagatgtcatc
ctcatgtgtttctcaatagacagtcccgacagtttagagaatatcccagaaaagtggacg
ccggaggtgaagcacttctgcccaaacgttcccataatcctcgtgggcaataagaaggat
ctgcggaatgatgagcacacacggagagagttgactaagatgaagcaggagccggttaaa
ccggaggagggcagggacatggccaatcgcattagtgccttcggctacctggaatgctca
gctaagactaaggacggcgtgagggaagtattcgaaatggccaccagggcggcgctgcaa
gtccgcaagaggaagaagaggagcggctgcttgctgttgtga

KEGG   Sinocyclocheilus rhinocerous: 107709246
Entry
107709246         CDS       T04916                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107709246
   04350 TGF-beta signaling pathway
    107709246
   04150 mTOR signaling pathway
    107709246
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107709246
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107709246
   04520 Adherens junction
    107709246
   04530 Tight junction
    107709246
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107709246
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107709246
   04625 C-type lectin receptor signaling pathway
    107709246
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107709246
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107709246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107709246
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107709246
   04031 GTP-binding proteins [BR:srx04031]
    107709246
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107709246
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107709246
  Exosomal proteins of other body fluids (saliva and urine)
   107709246
  Exosomal proteins of colorectal cancer cells
   107709246
  Exosomal proteins of bladder cancer cells
   107709246
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107709246
SSDB
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU Gtr1_RagA
Other DBs
NCBI-GeneID: 107709246
NCBI-ProteinID: XP_016369169
LinkDB
Position
Unknown
AA seq 159 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQAGPFYLVKCMILKGKGHPAMNIS
NT seq 480 nt   +upstreamnt  +downstreamnt
atggctgccattcgtaagaaactcgttatagtgggtgatggagcctgtggaaagacctgt
ttgcttattgttttcagtaaagatcagtttcctgaagtctacgtacccacagtttttgag
aactacgttgcagacatcgaggtcgatggaaaacaggtagagcttgccttatgggatacg
gctggacaggaggactatgatcggttaagacctctctcctaccctgacacagatgtcatt
cttatgtgcttttccatcgacagtcccgatagcttggagaatattccagaaaagtggaca
ccagaggtgaagcatttctgtccgaatgttcccatcatcctcgttggtaacaaaaaggat
ctccgaaatgatgagcacacacgaagggaacttgccaaaatgaaacaggcagggcctttt
tacttagtaaaatgtatgattcttaaaggaaaaggtcatccagcaatgaacattagctga

KEGG   Sinocyclocheilus rhinocerous: 107711944
Entry
107711944         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107711944
   04350 TGF-beta signaling pathway
    107711944
   04150 mTOR signaling pathway
    107711944
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107711944
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107711944
   04520 Adherens junction
    107711944
   04530 Tight junction
    107711944
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107711944
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107711944
   04625 C-type lectin receptor signaling pathway
    107711944
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107711944
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107711944
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107711944
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107711944
   04031 GTP-binding proteins [BR:srx04031]
    107711944
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107711944
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107711944
  Exosomal proteins of other body fluids (saliva and urine)
   107711944
  Exosomal proteins of colorectal cancer cells
   107711944
  Exosomal proteins of bladder cancer cells
   107711944
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107711944
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107711944
NCBI-ProteinID: XP_016372525
UniProt: A0A673H7T6
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELIKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRGGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagctatccgtaagaagctggtgattgtgggagatggagcctgtgggaaaacctgc
ttgctgattgtgttcagtaaagatcagttccccgaggtctacgtgcctacagtgtttgaa
aactacatcgctgatatagaggtggacagcaaacaggtggagttggctctatgggacaca
gctggtcaggaagactatgatcggttgaggccattgtcatatccagacacggatgttatt
ctgatgtgtttctctatagacagtccagatagtttagaaaatattccagagaaatggacg
ccagaggtaaaacatttctgtcccaacgttcccatcatccttgtgggcaataaaaaggac
ctgcggaatgatgaacacacacgcagggagctgattaagatgaaacaggaacctgtaaaa
ccagaggagggccgtgacatggctaacaggatcagtgcatttggatatttagagtgttcg
gctaaaactaaagatggagtgcgggaggtgtttgagatggccaccagggcggcactgcag
gtccgcaaacgcaagaagagaggcggctgcctgctgttatga

KEGG   Sinocyclocheilus rhinocerous: 107711976
Entry
107711976         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107711976
   04350 TGF-beta signaling pathway
    107711976
   04150 mTOR signaling pathway
    107711976
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107711976
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107711976
   04520 Adherens junction
    107711976
   04530 Tight junction
    107711976
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107711976
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107711976
   04625 C-type lectin receptor signaling pathway
    107711976
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107711976
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107711976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107711976
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107711976
   04031 GTP-binding proteins [BR:srx04031]
    107711976
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107711976
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107711976
  Exosomal proteins of other body fluids (saliva and urine)
   107711976
  Exosomal proteins of colorectal cancer cells
   107711976
  Exosomal proteins of bladder cancer cells
   107711976
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107711976
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra
Other DBs
NCBI-GeneID: 107711976
NCBI-ProteinID: XP_016372575
UniProt: A0A673HJI9
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNKCSLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcaattcgcaagaagctggtgattgtaggagatggagcgtgcggtaaaacctgt
ttgcttatcgtgttcagtaaagaccagtttcccgaagtctatgtccccacggtgtttgag
aactatgtcgccgacattgaggttgacagcaaacaggtggaacttgctctttgggatacc
gcaggacaggaggactacgataggctccgtcctctttcgtacccagacactgatgtcatt
cttatgtgcttctctattgatagtcctgacagtttagagaatattccagagaagtggaca
cccgaggtgaaacacttttgcccaaatgttcccatcatccttgtcggcaacaaaaaggac
ctgcggaatgatgaacacacacgcagggagctgaccaagatgaagcaggagcctgttaag
gcagaggaagggagagacatggccaatcggattggagcatttggttatatggagtgctca
gccaaaacaaaagatggtgttcgggaggtgtttgaaatggccactagagcggcgttgcag
gcacgcaggggaaagaagagcaacaaatgcagtctgctgtga

KEGG   Sinocyclocheilus rhinocerous: 107719044
Entry
107719044         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107719044
   04350 TGF-beta signaling pathway
    107719044
   04150 mTOR signaling pathway
    107719044
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107719044
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107719044
   04520 Adherens junction
    107719044
   04530 Tight junction
    107719044
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107719044
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107719044
   04625 C-type lectin receptor signaling pathway
    107719044
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107719044
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107719044
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107719044
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107719044
   04031 GTP-binding proteins [BR:srx04031]
    107719044
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107719044
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107719044
  Exosomal proteins of other body fluids (saliva and urine)
   107719044
  Exosomal proteins of colorectal cancer cells
   107719044
  Exosomal proteins of bladder cancer cells
   107719044
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107719044
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 107719044
NCBI-ProteinID: XP_016381834
UniProt: A0A673L9P4
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRHDEHTRRELFKMKQEPVKPEEGRDMANRICAFGYMECSAKSKDGVREVFEMATRAALQ
ARKGKKSSKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcggcgatccgtaagaaactggtgatcgtgggcgacggcgcgtgcgggaagacctgc
ctgctcatcgtcttcagcaaagaccagttccccgaggtctacgtgcccaccgtcttcgag
aactacgtggccgacatcgaggtggacagcaagcaggtggagctagcgctgtgggacacg
gcgggtcaggaggactacgaccgtctgcggccgctctcttaccccgacaccgacgtcatc
ctcatgtgcttctccatcgacagccccgacagcctggagaacattcccgagaaatggact
ccggaggtcaagcacttctgccccaacgttcccataatcctggtgggcaacaagaaggac
ctgcgccacgacgaacacactcgccgcgagctcttcaagatgaagcaggagcccgtcaag
ccggaggagggccgagacatggccaaccgcatctgtgccttcggatacatggagtgctcc
gccaaaagcaaggacggcgtgcgggaggtgtttgagatggccaccagggcggcgctgcag
gcacgcaagggcaagaagagcagcaaatgcctgctgctgtag

KEGG   Sinocyclocheilus rhinocerous: 107729745
Entry
107729745         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107729745
   04350 TGF-beta signaling pathway
    107729745
   04150 mTOR signaling pathway
    107729745
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107729745
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107729745
   04520 Adherens junction
    107729745
   04530 Tight junction
    107729745
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107729745
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107729745
   04625 C-type lectin receptor signaling pathway
    107729745
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107729745
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107729745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107729745
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107729745
   04031 GTP-binding proteins [BR:srx04031]
    107729745
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107729745
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107729745
  Exosomal proteins of other body fluids (saliva and urine)
   107729745
  Exosomal proteins of colorectal cancer cells
   107729745
  Exosomal proteins of bladder cancer cells
   107729745
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107729745
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107729745
NCBI-ProteinID: XP_016395906
UniProt: A0A673J840
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ
VRKRKKRSGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcggctatcaggaaaaagctggtgatcgtaggagatggagcgtgtgggaagacctgt
ctcctcatagtgttcagcaaagaccagtttccagaagtctatgtgcctactgtgttcgag
aactacattgcagacatcgaagtcgacagcaaacaggtggagctggcattgtgggacaca
gcaggacaggaagactacgatcgtctgaggcctctgtcttatccagacacggatgtcatc
ctcatgtgtttctccatagacagtcccgacagtttagagaacattccagaaaagtggacg
ccggaggtgaagcacttctgccccaacgttcccataatcctggtgggcaataagaaggat
ctgcggaacgatgaacacacacggagagagctgactaagatgaagcaggagccagttaaa
ccggaggagggcagggacatggccaaccgcattagcgcctttggctacctggagtgctcc
gctaaaacgaaggagggcgtgagggaagtattcgaaatggccaccagggcggcgctgcaa
gtccgcaagaggaagaagaggagcgggtgcttgctgttgtga

KEGG   Sinocyclocheilus rhinocerous: 107737929
Entry
107737929         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107737929
   04350 TGF-beta signaling pathway
    107737929
   04150 mTOR signaling pathway
    107737929
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107737929
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107737929
   04520 Adherens junction
    107737929
   04530 Tight junction
    107737929
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107737929
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107737929
   04625 C-type lectin receptor signaling pathway
    107737929
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107737929
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107737929
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107737929
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107737929
   04031 GTP-binding proteins [BR:srx04031]
    107737929
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107737929
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107737929
  Exosomal proteins of other body fluids (saliva and urine)
   107737929
  Exosomal proteins of colorectal cancer cells
   107737929
  Exosomal proteins of bladder cancer cells
   107737929
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107737929
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 107737929
NCBI-ProteinID: XP_016405057
UniProt: A0A673GJG8
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNIPIILVGNKKD
LRHDEHTRRELFKMKQEPVKPEEGRDMANRICAFGYMECSAKSKDGVREVFEMATRAALQ
ARKGKKSSKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcggcgatccgtaagaagctggtgatcgtgggcgacggcgcgtgcgggaagacctgc
ctgctcatcgtcttcagcaaagaccagttccccgaggtctacgtgcccaccgtcttcgag
aactacgtggccgacatcgaggtggacagcaagcaggtggagctagcgctgtgggacacg
gcgggtcaggaggactacgaccgtctgcggccgctctcttaccccgacaccgacgtcatc
ctcatgtgcttctccatcgacagccccgacagcctggagaacattcccgagaaatggact
ccggaggtcaagcacttctgccccaacattcccataatcctggtgggcaacaagaaggac
ctgcgccacgacgaacacactcgccgcgagctcttcaagatgaagcaggagcccgtcaag
ccggaggagggccgggacatggccaaccgcatctgtgccttcggatacatggagtgctcc
gccaaaagcaaggacggcgtgcgggaggtgtttgagatggccaccagggcggcgctgcag
gcacgcaagggcaagaagagcagcaaatgcctgctgctgtaa

KEGG   Sinocyclocheilus rhinocerous: 107748433
Entry
107748433         CDS       T04916                                 

Definition
(RefSeq) ras-like GTP-binding protein O-RHO
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107748433
   04350 TGF-beta signaling pathway
    107748433
   04150 mTOR signaling pathway
    107748433
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107748433
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107748433
   04520 Adherens junction
    107748433
   04530 Tight junction
    107748433
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107748433
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107748433
   04625 C-type lectin receptor signaling pathway
    107748433
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107748433
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107748433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107748433
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107748433
   04031 GTP-binding proteins [BR:srx04031]
    107748433
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107748433
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107748433
  Exosomal proteins of other body fluids (saliva and urine)
   107748433
  Exosomal proteins of colorectal cancer cells
   107748433
  Exosomal proteins of bladder cancer cells
   107748433
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107748433
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107748433
NCBI-ProteinID: XP_016418693
UniProt: A0A673IAE3
LinkDB
Position
Unknown
AA seq 97 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLGKTSS
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctgccattcgtaagaaactcgtcatagtgggtgatggagcctgtggaaagacctgt
ttgcttattgttttcagtaaagatcagtttcctgaagtctacgtgcccacagtttttgag
aactatgttgcagacatcgaggtcgatggaaaacaggtggagcttgccttatgggatacg
gctggacaggaggactatgatcggttaagacctctctcctaccccgacacagatgtcatt
cttatgtgcttttccatcgacagtcccgatagcttgggtaagacgtcctcgtaa

KEGG   Sinocyclocheilus rhinocerous: 107755302
Entry
107755302         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-A
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107755302
   04350 TGF-beta signaling pathway
    107755302
   04150 mTOR signaling pathway
    107755302
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107755302
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107755302
   04520 Adherens junction
    107755302
   04530 Tight junction
    107755302
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107755302
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107755302
   04625 C-type lectin receptor signaling pathway
    107755302
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107755302
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107755302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107755302
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107755302
   04031 GTP-binding proteins [BR:srx04031]
    107755302
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107755302
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107755302
  Exosomal proteins of other body fluids (saliva and urine)
   107755302
  Exosomal proteins of colorectal cancer cells
   107755302
  Exosomal proteins of bladder cancer cells
   107755302
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107755302
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra
Other DBs
NCBI-GeneID: 107755302
NCBI-ProteinID: XP_016427538
UniProt: A0A673HHK8
LinkDB
Position
Unknown
AA seq 193 aa
MTAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDDHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQ
AKKRGKKNPCALL
NT seq 582 nt   +upstreamnt  +downstreamnt
atgactgcaattcgtaagaagcttgtaatcgttggggatggagcatgtggaaagacgtgt
ttactcatcgttttcagtaaagaccagtttcctgaggtctacgtacccacagtgttcgag
aactatgttgctgatattgaggtggacagcaaacaggtggaactggctctatgggataca
gctggacaagaggactacgacaggctgaggcccctgtcctacccagacactgatgtcatc
ctcatgtgcttttccgtagacagccctgacagtttggagaatatcccagaaaaatggacg
ccggaggtaaaacatttctgtccaaatgtgccaataattctggtgggtaataaaaaagat
ttacggaatgatgatcacactcgacgggagctgcagaagatgaaacaggaaccagttaaa
ccagaggaagggcgagacatggctaatcgcatcaatgccttcggctaccttgagtgttcg
gctaaaactaaggagggcgtgagggaagtgttcgaaatggccacaagagcagcgctccaa
gccaaaaaacgtggcaagaagaatccctgcgctttgctatag

KEGG   Sinocyclocheilus rhinocerous: 107758012
Entry
107758012         CDS       T04916                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-A-like
  KO
K04513  Ras homolog gene family, member A
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04144  Endocytosis
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04350  TGF-beta signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107758012
   04350 TGF-beta signaling pathway
    107758012
   04150 mTOR signaling pathway
    107758012
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107758012
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107758012
   04520 Adherens junction
    107758012
   04530 Tight junction
    107758012
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107758012
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107758012
   04625 C-type lectin receptor signaling pathway
    107758012
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107758012
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107758012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107758012
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107758012
   04031 GTP-binding proteins [BR:srx04031]
    107758012
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107758012
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107758012
  Exosomal proteins of other body fluids (saliva and urine)
   107758012
  Exosomal proteins of colorectal cancer cells
   107758012
  Exosomal proteins of bladder cancer cells
   107758012
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107758012
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107758012
NCBI-ProteinID: XP_016431133
UniProt: A0A673M653
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDDHTRRELLKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQ
AKKRGKKNPCALL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcaatccgtaagaagcttgtaatcgttggggatggagcatgtggaaagacgtgt
ttactcatcgttttcagtaaagaccagtttcctgaggtctacgtacccacagtgttcgag
aactatgttgctgatatcgaggtggacggcaaacaggtggaactggctctatgggataca
gctggacaagaggactacgacaggctgaggcccctgtcctacccagacactgatgtcatc
ctcatgtgcttttccatagacagccctgacagtttggagaatatcccagaaaaatggacg
ccggaggtaaaacatttctgtccaaatgttccaataattctggtgggtaataaaaaagat
ttacggaatgatgatcacactcgacgggagctgctgaagatgaaacaggaaccagttaaa
ccagaggaagggcgagacatggctaatcgcatcaatgccttcggctaccttgagtgttcg
gctaaaactaaggagggcgtgagggaagtgttcgaaatggccacaagagcggcgctccaa
gccaaaaaacgtggcaagaagaatccctgcgctttgctatag

DBGET integrated database retrieval system