KEGG   Sinocyclocheilus rhinocerous: 107707822Help
Entry
107707822         CDS       T04916                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00512  Mucin type O-glycan biosynthesis
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    107707822 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:srx01003]
    107707822 (galnt9)
Enzymes [BR:srx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     107707822 (galnt9)
Glycosyltransferases [BR:srx01003]
 O-Glycan biosynthesis
  Mucin-type
   107707822 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 107707822
NCBI-ProteinID: XP_016367400
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQIGRLSDQRLRGRNAKVTNSMD
RQSILKRLERLEDVVYNQLNGLSKPMGLVEGPGGLGEGGAAATLGEDSRESEGRYEEYGY
NAQLSDRISLDRNIPDYRPKKCKQLTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTGWAEPILTRVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDRGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
NPGVDFGDVSERVALRKKMNCRNFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLDQG
SEEDDRAILYPCHGMSSQLARYTTEGLLQLGALGSTTFLPDTKCLVDDGRGRAPSLKKCD
AVTRSSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKHP
RH
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaagatcaaaactctgctgacggtcaacattctggtgttcgtcggt
atcatcttgttctccgtctactgcaggatccaggaccgatccgaagagctcgtgcagatc
gggaggctctcggatcagagactgcgaggcaggaatgccaaagttacgaactccatggac
agacagtccattctcaaaaggctcgagcgactagaagatgtggtctataaccagttaaat
ggtctatccaagcccatgggtctggtggagggtcctggaggtctgggagagggcggtgca
gctgccacgttgggggaggacagccgagagagcgaaggaaggtacgaggagtacggctac
aacgcccagctgagcgaccgcatctccttggacaggaacattccggactacaggcccaaa
aagtgtaagcagctgacctactctgatgaccttccccagatctctgtcgtcttcatcttt
gtgaatgaagctctgtctgtcatcctgcggtctgtacacagcgtggtcaaccataccccg
gcacacctgctcaaagaaatcatactggtggacgacaacagtgacagcgtggagctgaag
ttcaatctggatcaatacgtgaacaagcgatatcctggcctggtgaagatcgtgaggaac
agtaagagagagggactcatacgagccaggattcacggctggaacgcagccactgctcct
gttgtgggcttctttgacgcccacgtggagttcaacacaggctgggctgagcctatcctc
accagagtgaaagaagatcacactaggataatcctccccgcgatagataatatcaagtac
aacacctttgaggtgcagcaatacgctaatgcagctcatggctacaactggggcctctgg
tgcatgtacatcatcccaccacaggattggctggacagaggcgatgagactgcccccatc
aggacacctgcaatgattggctgctcctttgtggtggatcgtgagtattttggagaaatc
gggctgcttgacccgggcatggaggtttacggaggagaaaacattgaacttggtatgagg
aacccaggagtggattttggagacgtgtcagagcgtgtagcgctgaggaagaaaatgaac
tgcaggaactttcgctggtaccttgagcatgtctatcccgagatgagaatttacaataac
accatcacttatggagaggtgcgaaacagtaaagccagtggatattgccttgatcagggg
tcagaggaggatgacagggctattctctacccatgtcatggcatgtcatcgcagctggcg
aggtacaccactgagggcttattgcagttaggagccctggggtcgactacgtttctgcct
gacacaaaatgcctggtggatgatggaagaggaagggctccaagcttgaaaaaatgtgat
gctgtcaccaggtcctcccagaggctctgggattttactcagaatggacccatcataagt
cgagacacgggacgttgtttggaggttgaaatgtcaaaagatgcgaactttggcctgcgg
ctggtcgtccagcgttgctcagggcagaaatggatgattcggaactggataaaacacccc
agacactga

DBGET integrated database retrieval system