KEGG   Sinocyclocheilus rhinocerous: 107708252Help
Entry
107708252         CDS       T04916                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00010  Glycolysis / Gluconeogenesis
srx00051  Fructose and mannose metabolism
srx00052  Galactose metabolism
srx00500  Starch and sucrose metabolism
srx00520  Amino sugar and nucleotide sugar metabolism
srx00524  Neomycin, kanamycin and gentamicin biosynthesis
srx01100  Metabolic pathways
srx01200  Carbon metabolism
srx04910  Insulin signaling pathway
Module
srx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107708252
   00051 Fructose and mannose metabolism
    107708252
   00052 Galactose metabolism
    107708252
   00500 Starch and sucrose metabolism
    107708252
   00520 Amino sugar and nucleotide sugar metabolism
    107708252
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107708252
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107708252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107708252
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107708252
Membrane trafficking [BR:srx04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107708252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 107708252
NCBI-ProteinID: XP_016367925
LinkDB All DBs
Position
Unknown
AA seq 817 aa AA seqDB search
MENQIYAIPENIMRGSGTELFDHIAECLANFLEKLGIKDKKLPLGFTFSFPCQQTKLDES
FLVSWTKGFKASGVEGRDVVGLLRKAIKKRGDFDIDIVAVINDTVGTMMTCGYDDHHCEI
GLIVGTGTNACYMEEMRHLELVDGDEGRMCVNMEWGAFGDDGALDDIRTEFDREIDAGSL
NPGKQLFEKMISGMYMGELVRLILVKMAKDGLLFQGHTTPDLLTTGHFQTSFVSAIENKK
SSEGLLRAEQVLRGLGLDSSPEDCVAVQRVCQIVSTRAAHLSAHLCAAALAAVLRQIRDN
KATERLRTTVGVDGSVYKNHPQFARRLNKMVRLLVPDCDVRFLRSEDGSGKGAAMVTAVA
YRLAKQHAERQRILDSLRLDRDQLLEVKRRMEEEMKRGLAEKAHTTAAVKMLPTFVRATP
DGTERGDFLALDLGGTNFRVLLVRVRSGKRRSVEMHNKIYTIPQDITQGTGEELFDHIVH
CIADFLEYMGMKGASLPLGFTFSFPCHQTRLDQGILIKWTKGFKASGCEGEDVATLLKDA
IHRSEEFELDVVAVVNDTVGTMMTCGYEDPQCEVGLIVGTGTNACYMEEMSNVELVDGDE
GRMCVNMEWGAFGDRGELDDVCTEFDRAVDDQSTYPGKQRYEKMISGMYLGEIVRNVLLD
FTAKGLLFRGKLSERLKTRGIFETKFLSQIESDRLALRQVRSILQHLGLTSSTCDDSILV
KEVCSVVSKRAAQLCGAGLAAVVDKIRLNRDLEKLSITVGVDGTLYKLHPHFASIMRETL
RDLAPDCEVTLVQSEDGSGKGAALITAVACRLRDARK
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccagatctacgctattccagagaacatcatgaggggcagcgggacagagctc
ttcgatcacatcgctgaatgcttggctaatttccttgagaaactgggcatcaaagacaag
aagctgcctcttggctttaccttttcgtttccttgccagcagaccaagctagatgagagt
tttctggtgtcctggaccaaaggttttaaggcgagtggagtggaggggagagatgttgtg
ggcctgttgagaaaagccatcaagaagagaggggattttgacattgacattgtggctgtg
atcaatgacactgtcggcaccatgatgacctgcggctacgatgaccatcactgtgagatc
ggcctcatcgtcgggacgggcaccaatgcatgctacatggaggagatgcgtcacctggag
ctggtggatggagatgaagggcgcatgtgcgtgaacatggagtggggtgcgttcggcgac
gacggtgcattagacgacatccgcaccgaattcgaccgagagatcgacgctggctccctc
aaccctggaaaacagctgtttgagaagatgatcagtgggatgtatatgggtgagctggtc
agactgatcctggtgaagatggctaaagacggcctgctcttccagggacacaccactcca
gatctgctcaccactggccacttccagacctccttcgtctctgccatcgagaataaaaag
agcagcgagggtctgctgagagcggagcaggttttgagaggactggggctggactcgtct
ccggaggactgcgtggccgtacagagagtgtgtcagattgtctcgacacgagcagctcat
ctctcagctcatctctgtgccgccgcgctcgcagctgtcctgcggcagatccgggataac
aaagccacagagagactgcgcaccactgttggcgtggacggatcggtctacaagaaccac
ccacagtttgcccggcgactgaataagatggtgcggttattggtgccagactgcgatgtg
cgtttccttcgctcggaggacggcagcggtaaaggggcagcgatggtcactgctgtggcg
taccgattggcgaagcagcatgcagagcgccagcgtatcctcgacagcctccgcctcgat
cgagatcagctgctggaggtgaagagaaggatggaggaggagatgaagcgaggcttggct
gaaaaagcacacaccacggctgctgtcaaaatgctgcccacctttgtgcgcgccacgccg
gatggaacagagcgtggcgacttcttggcactggatctgggcggcacaaacttcagggtg
ctcttggtgcgtgttcgaagtgggaaaagacggagcgttgagatgcataataagatctac
accatccctcaagacattacccagggcaccggcgaggagttatttgatcacatagtgcac
tgcattgctgacttcctggagtatatgggtatgaagggagcatcgctgcctctgggattc
accttctcgtttccctgccatcagacccgactggatcagggaatcttgataaagtggaca
aagggcttcaaggcctcggggtgtgagggagaagatgtggccacgctactgaaagacgcc
atccatcgcagtgaggagtttgaactggatgtggtagcagtggtgaatgacaccgtgggc
accatgatgacttgtgggtacgaggatcctcaatgtgaagttgggcttattgtcggcaca
ggaactaatgcatgctacatggaggagatgtcaaacgttgagctggtggatggggatgaa
ggtcgtatgtgtgtgaacatggagtggggagcgtttggggaccgcggggagctggatgac
gtttgcacggagtttgatcgagccgtggatgaccagtccacttaccctgggaaacagcga
tatgagaagatgatcagcgggatgtatctcggagagatcgtcagaaacgtgctcttggac
ttcactgccaaaggcctgcttttccgtggcaaactttcagagagactgaaaacacgcggt
atcttcgaaaccaagttcctgtcgcagatcgagagcgatcgtttggcgctgaggcaggtg
cgctccatcctgcagcacctgggtttgaccagcagcacgtgtgatgacagtattctcgtg
aaggaggtttgcagtgtggtgtccaaacgtgcggcccagctgtgtggagccggtctggcg
gccgtggtggacaagatacgactgaaccgcgaccttgagaagctcagcatcactgttgga
gtggacggcacgctctacaaactccacccgcactttgccagcatcatgcgggaaacctta
agagacctggcccccgactgtgaggttactctcgtccaatcagaagatggcagcggaaaa
ggtgccgccctcatcacggccgtggcttgtcgattaagagacgctagaaagtag

DBGET integrated database retrieval system