KEGG   Sinocyclocheilus rhinocerous: 107708832
Entry
107708832         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107708832
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107708832
   04370 VEGF signaling pathway
    107708832
   04068 FoxO signaling pathway
    107708832
   04070 Phosphatidylinositol signaling system
    107708832
   04150 mTOR signaling pathway
    107708832
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107708832
  09143 Cell growth and death
   04210 Apoptosis
    107708832
   04218 Cellular senescence
    107708832
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107708832
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107708832
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107708832
   04625 C-type lectin receptor signaling pathway
    107708832
  09152 Endocrine system
   04910 Insulin signaling pathway
    107708832
   04914 Progesterone-mediated oocyte maturation
    107708832
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107708832
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107708832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107708832
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107708832
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107708832
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4037 DUF4135
Other DBs
NCBI-GeneID: 107708832
NCBI-ProteinID: XP_016368649
LinkDB
Position
Unknown
AA seq 1039 aa
MPPGVYGMQDVWEREGRQQVNMEFLLPTGIYLNFPVACSDTISTIKKMVWKNARNEPLFS
ALSDPDAYVFTCINMTAEREELEDEQRRLCDVRPFMPILRLVAREGDRVEKLITTQISLL
IGKGHHEFDSQKNHEVNEFRTKMRTFCEERAQVRQMLPWEPWMEFNFPCDLEPCSVVAQS
GKSHSGKKILVNVKFEGSEETFVLQQDPQDLPMFLKWNALRKKSTVFRSAKREKPEDYTL
QVNGRWEFIYGEYPLCQFKYIFTCLHGGITPHLTMVHHSVIIKYQEEQGGLSNQVSRTRA
QSKPPPLPLKRQNTSSLWSIHEPFYIYLLQGSRVNADEGMKLVVQAGLFHGSELLCKVVT
SNEVSVCSEPVWDQKLVFDIGVSDLPRMSCLCFALYGVIEKTKKRPTKKKNKRADCPLAW
VNTMVFDYKDQLKTGEFSLSTWPSVPDDKGDLLNPMGTVEKNPNIDSTAGLLIRFPNIRP
HPLYYPPIEKLNELGMNGEKVVATKEEHLKLREIVDNKNYTEFFEDEKELLWKLREEVRQ
RYPESLPKLLLITKWNKHEDVAQMVGLLRKWPELPAIHALELLDYSFPDPHVRSFTIRCL
RILRNDELFQYLLQLVQVLKYESYLDCDLTCFLLERALANKKIGHFLFWHLRSEMHVPSV
SLRFGLILEAYCRGSIFLIKSLMKQNEALNKMKALNDFVKSGSQKATRIQTTEDMKVCIK
QDTYMEALSDVVSPLNPSIVLCELCADKCKFMDSKMKPLWLMYKDKYDHVGIIFKNGDDL
RQDMLTLQMIQLMDVLWKTEGLDLRMLPYGCLSTGNKTGLIEVVKNSDTIANIQRNNSNS
AATAAFNKDALLNWLKSKNPGDKLDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRET
GQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQEGRTNNSEKFERFRECCEQAY
KILCRNGTLFVNLFALMKAAGLPELSSSKDIQYLKDSLALGKSEEEALKNFKVKFNEALR
ESWKTKVNWMMHSFAKDNR
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgccgccgggggtctacggcatgcaggatgtgtgggagagggagggtcggcaacaggtc
aacatggagttcctcctccccacggggatctacctcaactttcccgtagcatgcagtgac
accattagtaccatcaagaagatggtgtggaaaaatgccaggaatgagcctctgttcagt
gccctgagtgacccggacgcctacgtcttcacctgcatcaacatgaccgcggagcgggag
gagctggaagatgagcagcgccgcctgtgtgatgttcggccattcatgccaattctcagg
ctggtggcccgggaaggcgaccgagtcgagaagctcatcaccacccagatcagtctgctt
ataggaaaaggtcatcatgaatttgactcccaaaagaaccatgaggtgaatgaattccga
acaaaaatgcggacattttgtgaagagcgtgctcaggtgcgtcagatgttgccttgggaa
ccatggatggagttcaacttcccgtgtgacttggagccgtgctcggtagtggcgcaatct
gggaaatcgcacagcgggaaaaagattttggtcaatgtgaagtttgagggcagtgaggag
accttcgttctccagcaagatccacaggacctgccgatgtttctgaaatggaacgccttg
agaaagaagtccaccgtgttccgatcggccaagcgggagaagccagaggactacaccctt
caggttaacgggagatgggagttcatttatggagaatatccactctgccagtttaaatat
atttttacatgtttgcatggaggcattaccccacacctgaccatggtgcatcattcagtc
atcatcaagtaccaggaggaacagggtggcctcagtaaccaggtgtccaggactcgtgct
cagtccaaaccgcccccgctgcctctgaaaaggcaaaacacatcttcgctgtggtctatc
catgagcctttctatatataccttctacagggcagccgagtgaatgcagatgaaggcatg
aagctggtggttcaggctggcctcttccatggcagtgagctcctgtgcaaagtggtgacc
agtaatgaggtcagtgtttgctctgaacccgtatgggaccagaaactagtgtttgacatc
ggcgtgagtgacctgcctcgaatgagctgcctctgctttgccctctacggcgtcatcgag
aagaccaaaaagcgtcctaccaagaagaaaaacaaaagagcggactgcccgttggcctgg
gttaacacgatggtgtttgactacaaggaccagctaaaaactggagaattttccctttcc
acatggccatcagtcccagatgataaaggggatttgttgaatcctatgggcactgtggag
aaaaatccaaacattgacagcacggctggtctcctgattcggtttcccaacatcagacca
caccccctgtattatcctccaattgaaaagctaaatgagctgggtatgaacggtgaaaaa
gttgttgctacaaaagaagagcacctgaaactgagagagattgtggacaataaaaactac
acagagttctttgaggatgagaaggagcttctgtggaagttacgtgaagaggtgaggcag
cgatacccggagagcctccccaaactcctcctcatcactaagtggaacaaacacgaggac
gtggctcagatggttggtttgttacggaaatggccagaattgcctgctatacatgctcta
gaacttctggactacagtttccctgaccctcatgtccgctccttcaccatccgctgcctc
aggatcttgcgtaatgatgagctctttcagtacctcttgcaactggtgcaggttctgaag
tatgaatcctacctggattgtgacttgacctgtttcttgcttgagagagccctggccaac
aagaaaataggtcacttcttgttttggcaccttaggtcagaaatgcatgtgccctcagtc
agcttgagatttggacttatactggaggcgtactgtcgtgggagcatctttctcatcaag
agcttgatgaagcagaatgaggctctgaataaaatgaaggctctcaatgactttgtgaaa
tcaggcagtcagaaggcaaccaggatacagactacagaggacatgaaagtgtgcatcaaa
caggacacttacatggaggcgctttcggatgtcgtctcccctctcaacccaagcatcgtg
ctgtgtgaactatgtgcagacaagtgtaagttcatggactccaaaatgaaacctctgtgg
ctgatgtataaggacaaatatgatcatgtgggcattatcttcaaaaatggagacgatctg
cggcaggatatgctaacccttcagatgattcagctaatggatgttttgtggaaaacagaa
ggtcttgacctcagaatgctgccctatggatgcctgtcaaccgggaacaaaacgggtctc
atcgaggtggtgaaaaactcagacactatcgccaacatccagagaaacaacagcaacagt
gcagccactgctgccttcaataaggacgcccttctcaactggctcaaatccaaaaaccca
ggggataaactggatcaagccattgaggaattcaccctctcctgcgcaggctactgtgta
gccacatatgttctgggaataggggaccgtcacagtgacaatataatgatcagggaaacg
ggtcagttattccatatagacttcgggcactttttggggaactttaagagcaaattcggg
atcaacagagaacgtgtgcctttcattctgacatacgactttgtccatgtaatccaggag
ggacggaccaacaacagcgagaaatttgaacggtttcgtgagtgctgcgaacaagcctat
aaaatcctttgccggaatgggactctttttgtgaatctttttgccttgatgaaagctgca
ggactccctgagctcagttcttccaaagacatccagtatctcaaggactctttggcactg
gggaaatctgaggaggaagcactgaagaactttaaagtaaaatttaatgaagctctaaga
gagagctggaagaccaaggtgaactggatgatgcactcttttgccaaagataacagataa

KEGG   Sinocyclocheilus rhinocerous: 107709897
Entry
107709897         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107709897
   04370 VEGF signaling pathway
    107709897
   04068 FoxO signaling pathway
    107709897
   04070 Phosphatidylinositol signaling system
    107709897
   04150 mTOR signaling pathway
    107709897
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107709897
  09143 Cell growth and death
   04210 Apoptosis
    107709897
   04218 Cellular senescence
    107709897
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107709897
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107709897
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107709897
   04625 C-type lectin receptor signaling pathway
    107709897
  09152 Endocrine system
   04910 Insulin signaling pathway
    107709897
   04914 Progesterone-mediated oocyte maturation
    107709897
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107709897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107709897
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107709897
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 Laminin_I
Other DBs
NCBI-GeneID: 107709897
NCBI-ProteinID: XP_016370052
UniProt: A0A673N4G6
LinkDB
Position
Unknown
AA seq 725 aa
MAADGFQYRSLYSYCKDWEDDIDLEPGDILTVDKASLLSQGFKEGDKQHPECLGWILGFN
ERTKQRGNFPGTYVQYVGPLKMSVPSCQPRSQRLLPAVPRPEPTASSQVAPVLDLTKQFT
HPETTAPNLMKLVEAIERTGLDSRTLYRTSTASASDRQSPAELQELDVGQWDIHALSEAL
VRYLQELPAPIIPPSVYTDLQAAVQLESDVSSVRRQEQLLQVLEKPEVPLQNLLTLHYLL
KHLEKVCQRAAQNGLDIHTLGQIFGPLLIRDPVSGSEEDEGFPVIAVERLLLERIWEQEP
TPPALPPKPPKAKAMASSVTNGNNSLLSEAEWYWGDISREEVNEKLRDTPDGTFLVRDAS
SKVQGEYTLTLRKGGNNKLIKIFHRGGKYGFSEPLTFLSVVELINHYRHESLAQYNAKLD
TRLLFPVSKYQQDQVVKEDSVEAVGEQLKVYHEQYQEKSREYDVLYEEYTRTSQELQMKR
TAIEAFNETIKIFEEQCETQERLSRESIEKYRREGNDKEIERIQSNSEKLKSRVTEIHDS
KSKLELDLKRQATDNREIDKRMNSLKPDLIQLRKIRDQYLVWLTQKGTKQRKINEWLGIK
NESEDLYSLLDDDDDQAHHDECTWYVGDIKRTQAEDLLRGKRDGTFLIRESQTQKGSFAC
SVVMDGEIKHCVVYKTATGFGFAEPYNLYGSLKDLVLHYKHTSLVQHNDTLNVTLAYPVL
AQQPR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggctgccgatggcttccagtacaggtctctgtactcctactgtaaagactgggaggat
gacattgaccttgagcctggtgatatcctgacggtcgacaaagcatctctgctgtcacag
ggctttaaagagggagacaagcagcacccagaatgcctcggctggatcttgggctttaac
gagcgaaccaaacagaggggaaactttccagggacgtatgtgcagtatgtgggacctttg
aaaatgtcagtgccgtcctgccagcctcgttctcagagactgcttcctgctgttcccaga
cctgagccaacagcctcctcgcaggttgctccagtcctggacttgaccaaacagttcaca
cacccggaaacaactgctcctaatcttatgaagttggtcgaagcaattgagcggacaggt
ctggactccaggacactatacaggacatccactgcttcagcctctgacagacagagccct
gctgagctgcaggagttggacgtgggacagtgggacattcatgcactctcggaggctctc
gttcggtacctgcaggaacttcctgcccccatcatccctccctctgtttatacagacctt
caggcagcagtgcaactagaatcagacgtttcctccgtgaggagacaagagcagctgctg
caggtactggagaagcctgaagttccactgcagaaccttctgacgctgcattatttgctc
aaacacctggagaaggtctgccagcgcgctgcgcagaacggcctcgacattcacaccctc
ggccaaatctttggccctctgttgatcagggaccctgtgagcgggtcagaggaagatgag
gggtttcccgtgattgcagttgagagacttcttttggagagaatttgggaacaagagccg
actcctcccgctctccctcctaaaccgcccaaagccaaagccatggcctcatctgtgacc
aatggaaacaacagcttactgagtgaagctgaatggtactggggagacatttcaagagag
gaggtgaatgagaagttgagagacactcctgatggtacgttcctggtgcgggacgcatca
agcaaagtccagggagagtataccttgaccctcaggaaaggaggcaataacaaactgatc
aagatttttcaccgcggggggaagtatggcttctcagagcctcttacttttctctctgtg
gtggagctcatcaaccactaccggcatgagtcgctggcccaatacaacgccaagctggac
actcgcctgctcttccctgtgtctaaatatcagcaggatcaggtggtgaaagaggacagt
gtcgaggcagtaggagagcagctgaaggtttatcatgagcagtatcaggagaagagtcgt
gaatatgatgtactgtatgaagaatacacacgcacatcacaagagctgcagatgaaacga
acagccatagaggcctttaatgagaccataaagatctttgaggagcagtgtgaaacccag
gagcgcctcagcagagaaagcattgagaagtatcgccgagaaggcaacgacaaggagatt
gagagaattcagagcaactctgagaagctgaaatccagagtgacagagattcatgacagc
aagagtaagttggaactggacttgaagcgacaagccacagacaatcgagagatagacaag
aggatgaacagcttgaaaccagacctcatacagctgaggaagataagggaccaatatctt
gtatggttgactcagaaaggcaccaaacaaaggaagatcaacgaatggctgggtataaag
aacgaatcagaggacttgtattctctgttggatgacgatgacgatcaagcacatcatgac
gagtgtacctggtacgttggggacatcaagcgcacacaggcggaggatctcctgagaggc
aaacgagacggcaccttcctcatcagagagagccagacccagaagggctccttcgcctgc
tctgtagtcatggatggagagatcaaacattgtgtggtttacaagacggccacaggtttt
ggatttgctgagccttacaacctttacggttccttgaaagacttggtcctgcactacaaa
cacacctctctggtccagcacaacgacacactgaatgtaaccctggcctatccggtcctc
gcacagcagcctagatga

KEGG   Sinocyclocheilus rhinocerous: 107711700
Entry
107711700         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107711700
   04370 VEGF signaling pathway
    107711700
   04068 FoxO signaling pathway
    107711700
   04070 Phosphatidylinositol signaling system
    107711700
   04150 mTOR signaling pathway
    107711700
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107711700
  09143 Cell growth and death
   04210 Apoptosis
    107711700
   04218 Cellular senescence
    107711700
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107711700
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107711700
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107711700
   04625 C-type lectin receptor signaling pathway
    107711700
  09152 Endocrine system
   04910 Insulin signaling pathway
    107711700
   04914 Progesterone-mediated oocyte maturation
    107711700
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107711700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107711700
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107711700
SSDB
Motif
Pfam: SH2 PI3K_P85_iSH2 OB_RNB
Other DBs
NCBI-GeneID: 107711700
NCBI-ProteinID: XP_016372207
UniProt: A0A673L839
LinkDB
Position
Unknown
AA seq 349 aa
MSSSAEPFSYIEMSRVSAAGTVISSDEHLLREMEPNDLQEAEWYWADISREEVNEILHGM
PDGAFLVRNASCKRQGEYTLTVRNNGTNKLIRIHHQDGKFGFSEPLTFSSVPELISYYRH
RSLVQYNSSLDVTLAYPVSHCDPLRTFSDLPVKEEFLSATREKLQECLRLFQKTAEYDQL
YDACTTLLQEIQRRNTFEAVSLTEISKEQCYSQENSCKDFQDPVQSELKESEYEVKEEEE
KSVELLEEESWFVGDLGRRQAEELLQGKPSGAFLIRNSSTKDCYACSVVVGSQVRHCVIR
HTERGFGFVEPFDLHKSLKDLVMHYHHTSLAQHNQALDVRLAYPVHMSS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtcatcgtctgcagaaccgttttcctacatcgaaatgagtcgagtcagcgcagctggc
actgtcatcagtagcgacgaacatctcctaagagaaatggagcccaatgatttacaggag
gcagagtggtactgggctgacatatcaagggaggaggtgaacgaaatactccacggcatg
cctgatggtgctttcctggtccgaaatgcctcctgcaagcggcagggagaatatacatta
actgttaggaacaatggcaccaacaaactcatcaggatccaccatcaagatgggaaattt
ggcttctctgagcctctgaccttcagctcagtgccggagctgatatcttactacaggcat
cggagcttagtccagtacaacagctccctggatgtcacgctggcttatcccgtgtcccac
tgtgacccacttcgtaccttttcagatctgcctgtgaaggaagagtttttgagtgcaacc
agagagaaactccaagaatgtttaagactgtttcagaagacggccgagtatgaccagctc
tatgatgcttgcactacgctattacaggaaatccaaaggagaaatacatttgaggccgtc
agtctgaccgagatctctaaagagcagtgttattctcaagagaactcttgcaaggatttc
caagacccagtccagagtgagctgaaagagtctgaatatgaggtgaaagaggaggaggag
aagagtgtggagctcctggaggaagagagctggtttgtgggggatctcggtcgacggcag
gcagaggagcttctccaggggaagccgtctggagctttcctcatccgcaacagcagcacc
aaggactgttacgcctgctctgtggtggtcggcagccaggtgaggcactgcgtgattcgc
catacggagcgcggcttcgggttcgtcgaaccgttcgatctccacaagtctctgaaggat
ctggtcatgcactaccatcacacctcgctggcacagcacaaccaggctctggacgtccgg
ctcgcgtatccagtccacatgtccagctga

KEGG   Sinocyclocheilus rhinocerous: 107717145
Entry
107717145         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107717145
   04370 VEGF signaling pathway
    107717145
   04068 FoxO signaling pathway
    107717145
   04070 Phosphatidylinositol signaling system
    107717145
   04150 mTOR signaling pathway
    107717145
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107717145
  09143 Cell growth and death
   04210 Apoptosis
    107717145
   04218 Cellular senescence
    107717145
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107717145
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107717145
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107717145
   04625 C-type lectin receptor signaling pathway
    107717145
  09152 Endocrine system
   04910 Insulin signaling pathway
    107717145
   04914 Progesterone-mediated oocyte maturation
    107717145
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107717145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107717145
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107717145
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 SH3_2 Bap31_Bap29_C DUF5638
Other DBs
NCBI-GeneID: 107717145
NCBI-ProteinID: XP_016379298
LinkDB
Position
Unknown
AA seq 734 aa
MSFDSFQYRALFEYKQEPGDDISLQPGDLLMVSKMALLTSDYQEGDEKCPKGWLHGTNER
TKEKGNFPGTFVEYVGVVRTGLTSGKPWPRPVPPTPVGPQPPGASASEGPCGKGDVVEQC
ALHDQTPAVVLRLTEALERLDWENEPLYRSGQTSTGSPELLQTLETDPAVVDFEQYELST
LADTLKSYIQDLPCLLIPAVVYSELVYTAQETQNMEECGQQLKRILDSPSVPQANHQLLV
HLTRHLSKVAQSGGAAQTSPRLLALAYSEAIFKNNHFSADVNPEHHVKILEALIMVGGLV
EIQPAPALPPKPTKPMTPVNGNGVKEVASGSLQEAEWYWGDISREEVNDKLRDMPDGTFL
VRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFSSVVELISHYRHESLAQY
NTKLDVKLMYPVSRYQQDQLVKEDNIDAVGRKLQEYHNQYQEKSKEYDRLYEEHTKTSQE
IQMKRTAIEAFNETINIFEEQCHTQERYSKEYIERFRREGNDKEIERIMMNYEKLKSRLG
EIHDSKTRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRIND
WLGIKNENTDDTYFVSEEDENLPHYDEKSWFVGDLNRTQAEDLLHGKPDGAFLIRESSKK
GCYACSVVVDGEVKHCVIYSTPRGYGFAEPYNLYSTLKDLVLHYHQTSLVQHNDSLNVRL
AYPVYAQMPSGPRR
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgagctttgacagtttccagtaccgtgcactgttcgagtacaagcaggagccgggtgac
gatatctccctgcagcctggagatctcctcatggtcagtaagatggcactgctgacatcc
gattaccaggagggtgacgagaagtgcccaaagggctggctgcatggcaccaatgaacgc
actaaggagaagggcaacttccccggcacctttgtggagtatgttggggtcgtgaggaca
ggccttacttcagggaagccttggccgagacctgtaccgccaacacctgtagggccccag
cccccaggagcctctgcttcagaaggcccctgtggaaagggagatgttgtggagcagtgc
gctctgcatgaccagaccccagccgtggtgctcaggctgactgaggctctagagagactg
gactgggagaatgagccattgtaccggtctggccaaacctcgactggatccccagaatta
ctgcagactttggaaacagacccagcagtagtggactttgagcaatatgaattgtccaca
ttggctgatacacttaagagttacattcaggacttgccctgcctgctcataccagctgta
gtgtacagcgagctggtctacactgctcaggaaacccaaaacatggaggaatgcggacaa
cagctgaaaagaatccttgactctcctagtgtccctcaggctaaccaccagctcctggtt
catctgacccgacacctaagtaaggtggcccaaagtggtggagcagctcagacaagcccc
agacttctggctctggcctacagcgaggccatctttaaaaacaaccacttcagtgcggat
gtaaacccagaacatcatgtgaaaattctagaggcacttatcatggttggaggtctagtg
gagatacaacctgctccagctcttcctcccaagccaacaaaacccatgacaccagtaaat
ggcaacggtgtgaaagaagtcgccagcggctcattgcaagaagcagaatggtactgggga
gacatatcaagggaagaggtgaacgacaaactgagagacatgcctgatggtactttcctg
gtacgggacgcctcgaccaagatgcagggagattacacgctaacgctaaggaaaggtgga
aacaataagctaataaagatctatcatcgggatgggaagtacggattctcagacccgctc
acattcagctcagtggtggagctcatcagtcactacaggcacgagtcactggcccagtac
aacaccaaactggacgtaaagctcatgtatcctgtctcccgctaccagcaggatcagctg
gtgaaagaggacaacattgatgcagtggggaggaaactccaggaatatcacaatcaatat
caggagaagagtaaagaatatgacagactctatgaggagcacacaaaaacctcacaggag
atccagatgaaacgtactgcaatagaggccttcaatgagaccattaacatttttgaagag
cagtgtcacacgcaggaacgctacagtaaagaatacattgagcgattccgcagagagggc
aatgacaaagagattgaaaggattatgatgaactatgagaagctcaaatcccgtcttggc
gagattcacgacagtaagacccggcttgaacaggacctgaaaacacaggctctagacaac
agggagacggacaagaaaatgaacagcttgaagccagatcttattcagctcagaaagatt
agagatcagtaccttgtttggctcaatcataaaggtgttcgacagaaacgaataaacgat
tggctggggattaaaaacgagaacacggatgacacctacttcgtcagtgaggaggatgag
aatctgccacactacgatgagaagagctggtttgtgggggaccttaaccgaacgcaggca
gaggacttgctacacggcaaacccgatggagccttcctcatccgcgagagcagcaagaag
ggctgttacgcctgctctgttgttgtggacggcgaggtgaagcactgtgtcatctacagc
acaccccgcggctacggtttcgctgagccctacaacttgtacagcactctgaaagacttg
gtcctgcattaccaccagacctcactggtccagcacaacgactcgctcaatgtgcggctg
gcgtacccagtgtatgcacagatgccctcaggcccacggagatga

KEGG   Sinocyclocheilus rhinocerous: 107718208
Entry
107718208         CDS       T04916                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107718208 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107718208 (pik3ca)
   04370 VEGF signaling pathway
    107718208 (pik3ca)
   04068 FoxO signaling pathway
    107718208 (pik3ca)
   04070 Phosphatidylinositol signaling system
    107718208 (pik3ca)
   04150 mTOR signaling pathway
    107718208 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107718208 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    107718208 (pik3ca)
   04218 Cellular senescence
    107718208 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107718208 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107718208 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107718208 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    107718208 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107718208 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    107718208 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107718208 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107718208 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107718208 (pik3ca)
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107718208 (pik3ca)
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107718208 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 C2 Ribosomal_S15
Other DBs
NCBI-GeneID: 107718208
NCBI-ProteinID: XP_016380674
UniProt: A0A673JN71
LinkDB
Position
Unknown
AA seq 1069 aa
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDASGSHSRALYVYPPNVESSSELPKH
IYGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYVRSCIMLGRLPNLMLMSKDSLYSQLPMD
NFTMPSYARRISTATPYMNGEASTKSLWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDYF
SSPVKYPDMATIEDHANWIISREMGYNYCQSGQSSRLARDHAMTEADIEQLRQLGNRDPL
SEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKGEMYDMAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRHHAQN
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgcctccaagaccctcctcgggggaactatggggcatccatttgatgccccccaggatt
ctggtagactgtctactgcccaatggcatgatcttgacactagagtgtctccgggaggcc
accctcatcacaatcaaacacgaactgtttaaggaggcaaggaagtaccccctccaccac
ctgctgcaggaggagacatcctatattttcgtcagtgtaacgcaagaggcggagcgtgag
gagttctacgatgagacgagaagactttgcgaccttcggctgttccagcccttcctaaag
gtcatagaacctgtagggaacagagaggaaaaaatcctcaacagagaaatcggttttgcc
atcggcatgccggtgtgcgagtttgatctagtgaaggatcctgaggtgcaggactttagg
agaaatattcttaatgtctgcaaagactcagtagagctgcgagatgccagtgggtcacac
agtcgagcgctatatgtttatcctcctaacgtggagtcttcatcagagcttccaaagcat
atatatggcaaattagacaaaggtcaaatcattgtggtcatctgggtgatcgtctctccc
aacaacgacaagcaaaagtacacactaaagatcaatcacgactgcgtacctgagcaggtg
atcgctgaagccatcaggaagaagaccaggagcatgctgctgtccgctgagcaactaaag
atgtgcgtgcaagaatatcagggcaaatacatcctgaaagtctgcggctgtgacgagtat
ctgttggaaaagtaccccattagtcagtacaagtatgtacggagttgcattatgctgggt
cggttgccaaacctcatgcttatgtccaaggacagtctttactctcagctgcctatggac
aacttcaccatgccctcctacgcccgccgcatctccactgccacgccttacatgaacgga
gaggcctccaccaaatccctctggaccattaacagcactctaaggatacgtgtcctttgt
gccacatacgttaatgtgaatattcgggacattgacaagatttatgtgcggacagggatc
taccatggtggagaacaattgtgtgataatgtcaatacacagcgtgtgccgtgttcaaac
ccaaggtggaacgagtggctgacctatgacatgtacattcccgacatcccccgggcagct
cgcctctgtctctccatctgctctgtgaaaggaaggaagggggcaaaagaggagcactgt
ccactggcctggggaaacgtcaacctgtttgactacacacacactctggtctcaggaaag
atggcactgaacctgtggccagtaccacacggccttgaagacctcctcaaccccattggg
gtcacgggctccaaccctaataaggaaaccccatgtctagagctggagttcgactatttc
agctcccctgttaagtaccctgacatggccacgattgaggatcatgctaactggataata
tccagggagatgggatacaattactgccagtctggacagagcagcagactcgcacgagac
cacgccatgacggaggctgatatagagcaacttcgtcagctgggcaacagggacccgctt
tctgagatcactgagcaggaaaaagacttcttatggagacacaggcagtattgtgtaaat
attccagaaattctgcccaagattcttctggcggtgaagtggaattctagggatgaagtt
gcacagatgtattgccttcttaaagactggcccgcaataaagccggaacaagccatggag
ttgcttgactgtaactatcctgatccaatgatccgagacttcgcagttcggtgccttgag
aagtatctgaccgatgacaaactctcgcagtacctcattcagttggttcaggttttgaag
tatgagcagtatcttgataacccactggtgcgatttctgctgaaaaaagctcttaccaac
cagaggattgggcacttcttcttttggcatttgaagtcagaaatgcacaataaaaccgtg
agtcagcggtttggtctgctgctggagtcgtactgtcgggcatgtggcatgtacctgaag
cacctgagcagacaggtggaagccatggagaagctcatcaacctcacagacattctcaaa
caggagaagaaggatgaaactcagaaggtgcaaatgaagttcctggtggaacagatgagg
cgaccagactacatggatgccctccaaaatttcacctctccactcaaccccgcccaccag
ctgggtaatctacgacttgaagactgcagaatcatgtcctctgccaagagaccgctctgg
ctgaactgggaaaatcctgacatcatgtccgaacttctcttccaaaacaatgagatcatc
ttcaagaatggggatgacctgcggcaagacatgctgacactacagatcatcagaataatg
gagaacatttggcaaaatcaggggctggacctgagaatgctcccttatggctgcttgtct
attggagactgcgtgggtctcattgaggtggtgagaagttcccacaccatcatgcagatt
cagtgtaaaggaggtctaaaaggtgcgcttcagtttaacagttcaacgttgcatcagtgg
ctaaaggacaagaataagggcgagatgtacgacatggccatcgacttgtttacacgatcc
tgcgctggctattgtgtggctactttcattctgggcatcggtgacagacacaacagtaac
atcatggtgaaggatgatgggcagctgtttcatatagattttggtcactttttggaccac
aagaagaagaagtttggctacaagcgagagcgagtgccgtttgtcttaactcaagacttc
ttaattgtgatcagcaaaggaggaacccaagagtgcactaaaaccagagagtttgagagg
ttccaggagatgtgctacaaggcttacttggctatcagacagcatgccaaccttttcata
aatctcttctccatgatgctgggctcaggcatgccagagctgcagtccttcgacgacatc
gcttacatccgaaagaccctggcactggacaaaacagagcaggaggccctagactatttc
atgaagcagatgaatgacgctcaccatggtggatggaccaccaagatggactggatcttt
cacaccatccgacaccatgcccaaaactga

KEGG   Sinocyclocheilus rhinocerous: 107718809
Entry
107718809         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107718809
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107718809
   04370 VEGF signaling pathway
    107718809
   04068 FoxO signaling pathway
    107718809
   04070 Phosphatidylinositol signaling system
    107718809
   04150 mTOR signaling pathway
    107718809
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107718809
  09143 Cell growth and death
   04210 Apoptosis
    107718809
   04218 Cellular senescence
    107718809
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107718809
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107718809
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107718809
   04625 C-type lectin receptor signaling pathway
    107718809
  09152 Endocrine system
   04910 Insulin signaling pathway
    107718809
   04914 Progesterone-mediated oocyte maturation
    107718809
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107718809
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107718809
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107718809
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107718809
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107718809
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4037 DUF4135 RWD
Other DBs
NCBI-GeneID: 107718809
NCBI-ProteinID: XP_016381519
UniProt: A0A673IRY7
LinkDB
Position
Unknown
AA seq 1039 aa
MPPGVYGMQDVWEREGRQQVNMEFLLPTGIYLNFPVACSDTISTIKKMVWKNARNEPLFS
ALSDPDAYVFTCINMTAEREELEDEQRRMRDVRLFLPILRLVAREGDRVEKLITTQISLL
IGKGHHEFDSQKNHEVNEFRTKMRTFCEERAQVRQMLPWDQWMEYNFTCDLEPCSVVAQS
GKSCSDKKIFVNVKFEGSEETFVLQQGPQDLPMFLKRNALRKKSTVFRSAKQEKPEDYTL
QINGRWEFIYGKYPLCQFKYIFTCLHGGITPHLTMVHHSVIIKYQEEQGGLSNQVSRSRA
QSKPPPLPLKRQNTSSLWSINEPFYIYLLQGSRVNADEGMKLVVQAGLFHGSELLCKVVT
SNEVSVCSEPVWDQKLVFDISVSDLPRMSRLCIALYGVIEKTKKRPTKKKNKSSDCPLAW
VNTMVFDYKDQLKTGEFSLSTWPSVPDDKGDLLNPMGTVEKNPNIDSTAGLLIRFPNIRP
HPLYYPPIEKLNELGMNGEKTVATKEEHLKLREIVDNKNYTEFFEDEKELLWKLREEVRQ
RYPESLPKLLLITKWNKHEDVAQMVGLLQKWPELPAIHALELLDYSFPDPHARSFTIRCL
RKLRDDELFQYLLQLVQVLKYESYLDCDLTCFLLERALANKKIGHFLFWHLRSEMHVSSV
SLRFGLILEAFCRGSIFHIKNLMKQNEALNKMKALNDFVKSGSQKATRIQTTEDMKVCIK
QDTYMEALSDVVSPLNPSIVLCELCADKCKFMDSKMKPLWLMYKNKYDTLGIIFKNGDDL
RQDMLTLQMIQLMDVLWKTEGLDLRMLPYGCLSTGNKTGLIEVVKNSDTIANIQRNNSNS
AATAAFNKDALLNWLKSKNPGDKLDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRET
GQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQEGRTNNSEKFERFRECCEQAY
KILCRNGTLFVNLFALMKAAGLPELSSSKDIQYLKDSLALGKSEEEALKNFKVKFNEALR
ESWKTKVNWMMHTFAKDNR
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgccgccgggggtctacggcatgcaggatgtgtgggagagggagggtcggcaacaggtc
aacatggagttcctcctccccacggggatctacctcaactttcccgtagcatgcagtgac
accattagtaccatcaagaagatggtgtggaagaatgccaggaacgagcctctgttcagt
gccctgagtgacccggatgcctacgtcttcacctgcatcaacatgaccgcggagcgggag
gagctggaagatgagcagcgtcgcatgcgtgacgttcggctgttcttgccaattctcagg
ctggtggcccgggaaggagaccgagtcgagaagctcatcaccacccagatcagtcttctt
ataggaaaaggtcatcatgaatttgactcccaaaagaaccatgaggtgaatgaattccga
acaaaaatgcggacattttgtgaagagcgtgctcaggtgcgtcagatgttgccatgggat
caatggatggagtacaacttcacatgtgacttggagccgtgctctgtagtggcacaatct
gggaaatcgtgcagtgacaaaaagatttttgtcaatgtgaagtttgagggcagtgaggag
accttcgttctccagcaaggtccacaggacctgccaatgtttctgaaacggaacgccttg
agaaagaagtccaccgtgttccgatcggcaaagcaggagaagccagaggactacaccctt
cagattaacgggagatgggagttcatttatggaaaatatccactctgccagtttaaatat
atttttacatgtttgcatggaggtattaccccacacctgaccatggtgcatcattcagtc
atcatcaagtaccaggaggaacagggtggcctcagtaaccaggtgtccaggagtcgtgct
cagtccaaaccacccccactgcctctgaaaaggcaaaacacgtcttcgctgtggtctatc
aatgagcctttctatatataccttctacagggtagccgagtgaatgcagatgaaggcatg
aagctggtggttcaggctggcctcttccatggcagtgagctcctgtgcaaagtggtgacc
agtaatgaggtcagtgtttgctccgaacccgtatgggaccagaaactagtgtttgacatc
agcgtgagtgacctgcctcgtatgagtcgcctctgcattgccctctacggcgtcatcgag
aagaccaagaagcgccctaccaagaagaaaaacaaaagttcggactgccctttagcctgg
gttaacacgatggtgtttgattacaaggaccagctaaaaactggagaattttccctgtcc
acatggccatcagtcccagatgataaaggagatttgttgaatcctatgggcactgtggag
aaaaatccaaacattgacagcacggctggtcttctgattcgctttcccaacatcagacca
caccccctgtattatcctccaattgaaaagctaaatgagctgggtatgaatggtgaaaaa
actgttgctacaaaagaagagcacctgaaactgagagagattgtggacaataaaaactac
accgagttctttgaggatgagaaggagcttctgtggaagttacgtgaggaggtgaggcag
cgatacccggagagcctccccaaactcctcctcatcactaagtggaacaaacacgaggac
gtggctcagatggttggtttgttacaaaaatggccagaattgcctgctatacatgctcta
gaacttctagactacagtttccctgaccctcatgcccgctccttcactatccgctgcctc
aggaagttgcgtgacgatgagctctttcagtacctcttgcaactggtgcaggttctgaag
tatgaatcctacctggattgtgacttgacctgtttcttgcttgagagagccctggccaac
aagaaaataggtcacttcttgttttggcacctcaggtcagaaatgcatgtgtcctcagtc
agcttgagatttggacttattctggaggcgttctgtcgtgggagtatctttcacatcaag
aacttgatgaagcagaatgaggctctgaataaaatgaaagctctcaatgactttgtgaaa
tcaggcagtcagaaagcaaccaggatacagactacagaggacatgaaagtgtgcatcaaa
caggacacttacatggaagcgctttcggatgtcgtttctcctctcaacccaagcatcgtg
ctgtgtgaactatgtgcagacaagtgtaagttcatggactcaaagatgaaacctctgtgg
ctgatgtacaagaacaaatatgatactttgggcattatcttcaagaatggagacgatttg
aggcaggatatgctaacccttcagatgattcagctaatggatgttttatggaaaacggaa
ggtcttgacctcagaatgctgccctacggatgcctgtcaactggaaataaaacgggtctt
attgaggtggtgaaaaactcagacactatcgccaacatccagagaaacaacagcaacagt
gcagccaccgctgccttcaacaaggacgctcttctcaactggcttaaatccaaaaaccca
ggggataaactggatcaagccattgaggaattcaccctctcctgcgcaggctactgtgta
gccacatatgttctgggaataggggaccgtcacagtgacaatataatgatcagggaaacg
ggtcagttattccatatagatttcgggcactttttggggaacttcaagagcaaattcggg
atcaacagagaacgtgtgcctttcattctgacatacgactttgtccatgtaattcaggag
ggacggaccaacaacagcgagaaatttgaacggtttcgtgagtgctgcgaacaagcctac
aaaatcctttgcaggaatgggactctttttgtgaatctttttgccttgatgaaagctgca
ggactccctgagctcagttcttccaaagacatccaatatctcaaggactctttggcactg
gggaaatctgaggaggaagcactgaagaactttaaagtgaaatttaatgaagctctaaga
gagagctggaagaccaaggtgaactggatgatgcacacttttgccaaagataacagataa

KEGG   Sinocyclocheilus rhinocerous: 107719529
Entry
107719529         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107719529
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107719529
   04370 VEGF signaling pathway
    107719529
   04068 FoxO signaling pathway
    107719529
   04070 Phosphatidylinositol signaling system
    107719529
   04150 mTOR signaling pathway
    107719529
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107719529
  09143 Cell growth and death
   04210 Apoptosis
    107719529
   04218 Cellular senescence
    107719529
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107719529
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107719529
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107719529
   04625 C-type lectin receptor signaling pathway
    107719529
  09152 Endocrine system
   04910 Insulin signaling pathway
    107719529
   04914 Progesterone-mediated oocyte maturation
    107719529
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107719529
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107719529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107719529
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107719529
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107719529
SSDB
Motif
Pfam: PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B
Other DBs
NCBI-GeneID: 107719529
NCBI-ProteinID: XP_016382436
LinkDB
Position
Unknown
AA seq 895 aa
MAPRPSSGELWGLHLMPPRILVDCCLPNGILVSLECLREAPLTSIKQQLFSEARKYPLYH
LLQEESCYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEKILNREIGFA
IGMPICEFELVKDPEVQDFRRNILSVCREAVEEREGGGAHTQALYVYPPNVESSAELPQH
IYSKLDKGRLIVTIWVIVSPSNSKQKYTLKITHDSLPEQLIAEAIRKKTRSMHLSAQQLR
LCVQEYQGQYMLKVCGCDEYLLEKHPLSQYKYIRSCITLGRLPHLMLVSKDSLYSQLPSS
GFMAPSYSRRTPQPSPCPGGGDPGSPRSLWAFNTHLRVRLLCATYVNVNIRDIDKIYVRT
GIYHGGEPLCDNVNTQRVPCSNPRWNEWLSYDIYLTDVPRSARLCLSICSVKGRKGAKEE
HCPLAWGNINLFDYKDTLVSGKVALGLWPVPHGLEDLLNPIGVSGSNPNKETPCVELEFP
WFNQTVVFPDEQQIEEHANWKSPYRRRTQSNCAHSAVETRCMSSPNKRKTSCGDIESLPK
LLLSVKWNSRDEVSQTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSS
AKRPLWLNWENPDIMSELLFTNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRML
PYGCLSIGDCVGLIEVVKNSHTIMQIQCKGGLKGALQFNSNTLHHWIRDKNKGEAYDRAI
DLFTRSCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPF
VLTQDFLIVISKGVQECTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLLLGCGMPELQ
SFDDIAYLRKTLALEKNQQEALEYFTKQMNDAHHGGWTTKMDWIFHTIRHMPNEH
NT seq 2688 nt   +upstreamnt  +downstreamnt
atggctcctcggccgtcctcaggagagttatgggggcttcacctgatgcctcctcggatc
ctggtggactgctgtctgccgaacgggatcctggtgagtctggagtgtctgagagaagct
cctctgaccagcatcaagcagcaactcttcagcgaggcccgcaaatacccgctctaccac
ctgctgcaggaggagtcctgctacatctttgtgggagtgacgcaggaggccgagcgcgag
gagttctacgacgagacgcggcgtctgtgtgacctgcggctctttcaccccatcctcaaa
gtcatcgagccgctggggaacagagaggagaagatcctcaaccgggagatcggtttcgct
atagggatgcccatctgtgagttcgagctggtgaaggatccggaggtgcaggacttccgc
aggaacattctgagcgtgtgcagggaggcggtggaggagcgcgagggaggaggcgcacac
acacaggcgctctacgtctatcctcccaacgtggagtcctccgccgagctgccgcagcac
atctacagcaaactcgacaaaggccgtctgatcgtcaccatctgggtgatcgtgtccccg
tctaactccaagcagaagtacactctgaagatcacacacgactctctgccggagcagctg
atcgctgaagccatccgcaagaagacgcgcagcatgcatctgtcagcgcagcagctgcgg
ctctgtgtgcaggagtaccagggccagtacatgctgaaagtgtgcggctgcgacgagtac
ctcctggagaaacaccccctcagccagtacaagtacatcaggagctgcatcacgctgggc
cgtctgcctcacctcatgctggtcagtaaggacagtctgtacagtcagctgccctccagt
ggcttcatggctccgtcgtacagccggcgcacacctcagcccagcccctgccctggagga
ggagaccccggctcaccacgctccctctgggccttcaacacacacctgagagtccggctg
ctgtgtgccacatacgtcaacgtcaacatcagagacatcgacaagatctacgtcaggaca
ggaatatatcacggaggagaaccgctgtgtgacaacgtcaatacacagagagtgccctgc
tccaacccgaggtggaatgagtggctgtcgtatgacatctacctgaccgatgttcctcgc
tctgctcgtctctgtctgtccatctgctccgtcaagggccgcaagggagccaaagaggaa
cactgtcctctggcctggggaaacatcaacctcttcgactataaagacacgctggtgagc
gggaaagtggctctgggtttgtggccggttcctcacggtctggaggatctgctcaacccc
atcggagtgtccggatccaacccaaacaaggagacaccgtgtgtggagctggagttcccc
tggtttaaccagaccgtggtgtttcccgatgagcagcagatagaagaacacgccaactgg
aaatctccatatcgcaggcggacgcagagcaactgcgcacactctgcagtcgagacccgc
tgtatgagctctccgaacaagagaaagacttcctgtggagacatcgaaagtcttcccaaa
ctcctgctgtccgtcaagtggaactcacgggacgaggtgtcacagactcagatgaagttc
ctggtggagcacatgtcccgcccagattacatggaggcgctgcagggttttgtttctcct
ctgaaccccgtacaccagctgggcaatctcaggttggaggagtgccgtatcatgtcttca
gccaagcggccgctgtggttgaactgggagaatccggatatcatgagcgagctgctcttc
accaataatgagatcatctttaaaaatggagatgatctacggcaagacatgctgacgctg
cagattattaaaatcatggagaatatctggcagaatcaggggctggacctgcgaatgctg
ccgtatggctgtctgtccatcggcgactgcgtgggtctcattgaggtggtgaagaactcg
cacaccatcatgcagattcagtgtaaaggaggcctgaagggggcgctgcagttcaacagc
aacacactgcaccactggatcagagacaagaacaagggagaggcgtacgacagagccatc
gatttattcacacgctcgtgtgccggatactgtgtggccacgttcattctgggcatcggc
gacagacacaacagcaacatcatggtgaaggagaacggacagctgttccacatcgacttc
ggtcactttctggatcataaaaagaagaaatttggatacaagcgagagcgagttcctttc
gttctcacgcaagacttcctgatcgtcatcagtaagggtgtgcaggagtgcaccaagacc
aaagagttcgagaggtttcaggagatgtgttataaagcgtatctggccatccgtcagcac
gccagcctcttcatcaacctcttctctctgctgctgggctgtgggatgcctgagctgcag
agcttcgacgacatcgcttacctgcgcaagacactggcgctggagaagaaccagcaggag
gctctggagtacttcaccaaacagatgaacgacgctcaccacggaggatggaccaccaag
atggactggatcttccacaccatcagacacatgcccaatgagcactga

KEGG   Sinocyclocheilus rhinocerous: 107722495
Entry
107722495         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107722495
   04370 VEGF signaling pathway
    107722495
   04068 FoxO signaling pathway
    107722495
   04070 Phosphatidylinositol signaling system
    107722495
   04150 mTOR signaling pathway
    107722495
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107722495
  09143 Cell growth and death
   04210 Apoptosis
    107722495
   04218 Cellular senescence
    107722495
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107722495
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107722495
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107722495
   04625 C-type lectin receptor signaling pathway
    107722495
  09152 Endocrine system
   04910 Insulin signaling pathway
    107722495
   04914 Progesterone-mediated oocyte maturation
    107722495
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107722495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107722495
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107722495
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 Ribosomal_L22e
Other DBs
NCBI-GeneID: 107722495
NCBI-ProteinID: XP_016386347
UniProt: A0A673MKT0
LinkDB
Position
Unknown
AA seq 663 aa
MAADGFQYRSLYSYSKDWEDDIDLEPGDVLTVDKASLLSLGIKEGEEEHPECIDWILGFN
ERTKQRGDFPGTYVQYVGPVQMSVPSCQPRSQRPLPAVPRPEPTASSQVAPVLDLTKQFT
HPETAPPNLIKLVEAIERTGLDSRTLYRTSTASASDRQSLAELQELDVGQWDIHALSEAL
IRYLQELPAPIIPPSVYTDLQAAVKLESDVPSERRREQLLQGLEKPEVPLQNLLTLHYLL
RHLEKVCQRAEQNGLDIHTLGQIFGPLLIRSPVSGSEEDEGFPAVAVERLLLERIWEQEP
TPPALPPKPPKAKAMASSVTNGNNSLLSEAEWYWGDISREEVNEKMRDTPDGTFLVRDAS
SKVQGEYTLTLRKGGNNKLIKVFHRGGKYGFSEPLTFLSVVELINHYRHESLAQYNAKLD
TRLLFPVSKYQQDQVVKEDSIEAVGEQLKVYHEQYQEKNREYDVLYEEYTRTSQELQMKR
TAIEAFNETIKIFEEQCETQERLSRESIEKFRREGNDKEIERIQSNSEKLKSRVTEIHDS
KRKLELDLKRQATDNREIDKRMNSLKPDLIQLRKLRDQYLVWLTQKGTKQRKINDWLGIK
NESEDFYSLLDDDDDQAHHDECAWYVGDIKRTQAEDLLRGKRDGTFLIRESQTQKGSFAC
SVV
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggctgccgatggcttccagtacagatctctgtactcctactctaaggactgggaggat
gacattgaccttgagcctggtgatgtcctgacggtcgacaaagcgtctctgctgtcactg
ggcatcaaagagggagaggaggagcacccagaatgcatcgactggatcttgggctttaac
gagcgaaccaaacagaggggagactttccagggacgtacgtgcagtatgtgggacctgtg
caaatgtcagtgccgtcctgccagcctcgttctcagagaccgcttcctgctgttcccaga
cctgagccaacagcctcctcgcaggttgctccagtgctggacttgaccaaacaattcaca
cacccggaaactgctcctcctaatcttattaagttggtcgaagcaattgagcggacaggt
ctggactctaggacactttacaggacatccactgcttccgcttctgacagacagagcctc
gctgagctgcaggagttggacgtgggacagtgggacattcatgccctctcggaggctctc
attcggtacctgcaggaacttcctgcccccatcatccctccctctgtttatacagacctt
caggcagcagtgaagctagaatcggacgtcccgtccgagaggagacgcgagcagctgctg
caggggctggaaaagcctgaagttccactgcagaacctcctgacgctgcattatttgctc
agacacctggagaaggtctgccagcgcgccgagcagaacggcctcgacattcacaccctc
ggtcaaatctttggccctctgctgatcaggagccctgtgagcgggtcagaggaagatgag
gggtttcctgcggttgcagttgagagacttcttttggagagaatttgggaacaagagccg
actcctcccgctctccctcctaaaccgcccaaagccaaagccatggcctcatctgtgacc
aatggaaacaacagcttactgagtgaagctgaatggtactggggagacatttctagagag
gaggtgaatgagaagatgagagacactcctgatggtacgttcctggtgcgggatgcatca
agcaaagtgcagggagagtataccttgaccctcaggaaaggaggcaataacaaactgatc
aaggtttttcaccgcggggggaagtatggcttctcagagcctcttacttttctctctgtg
gtggagctcatcaaccactaccggcatgagtcactggcccagtacaacgccaagctggac
actcgcctgctcttccccgtgtctaaatatcagcaggatcaggtagtgaaagaggacagt
atcgaggcggtaggagagcagctgaaggtttatcacgagcagtatcaggagaagaatcgt
gaatatgatgtactgtatgaagaatacacacgcacatcacaagagctccagatgaaacga
accgccatagaggcctttaatgagaccatcaagatctttgaggagcagtgcgagacccag
gagcgcctcagcagagaaagcattgagaagtttcgcagagaaggcaacgacaaggagatt
gagagaattcagagcaactctgagaagctgaaatccagagtgacagagattcatgacagc
aagaggaagttggaactggacttgaagcgacaagctacagacaatcgagagatagacaag
aggatgaacagcttgaaaccagacctcatacagctgaggaagctacgggaccaatatctt
gtatggttgactcagaaaggcaccaaacaaaggaagatcaacgactggctgggtataaag
aacgaatcagaggacttctattctctgttggatgacgatgacgatcaagcacatcacgat
gagtgcgcctggtacgttggggacatcaagcgcacacaggcggaggatctcctgagaggc
aaacgagatggcaccttcctcatcagagagagccagacccagaagggctccttcgcctgc
tctgtagtgtga

KEGG   Sinocyclocheilus rhinocerous: 107726123
Entry
107726123         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107726123
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107726123
   04370 VEGF signaling pathway
    107726123
   04068 FoxO signaling pathway
    107726123
   04070 Phosphatidylinositol signaling system
    107726123
   04150 mTOR signaling pathway
    107726123
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107726123
  09143 Cell growth and death
   04210 Apoptosis
    107726123
   04218 Cellular senescence
    107726123
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107726123
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107726123
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107726123
   04625 C-type lectin receptor signaling pathway
    107726123
  09152 Endocrine system
   04910 Insulin signaling pathway
    107726123
   04914 Progesterone-mediated oocyte maturation
    107726123
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107726123
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107726123
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107726123
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107726123
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107726123
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135
Other DBs
NCBI-GeneID: 107726123
NCBI-ProteinID: XP_016391113
UniProt: A0A673HKP4
LinkDB
Position
Unknown
AA seq 1067 aa
MPPAKTDQLDLWAESGLDGDDQVMVDFLLPTGIYIQMEVPRESTIQHIKLLLWKEAQTYP
LFSLLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLITRNCGRAERILDSKI
GVLIGKGLHELDALQDQQVKDFRSKMKRVSEEKMQRMQLMSCGEWLRSCYSTQLGTGSLE
NLIDKHEGVIKITMHYDQSQDTASLKVSLHCTVTELMDQALKKWQTTHGPEEDIGTRSDY
VLRVSGRFEFLFEDHPLNQCKYIRDCLLANESPHLTLVHCDVVKAMFEKEISTIGSVLAR
KTSNPPLPLPPKKRPPTQLHTCVWKVHSLFRINLVKGNKVNAEDTAKIQVRAGLFHGTEL
LCKTAVSSESSSRSEHVWNKTLEFDIAVCDLPRMARLCFAIYAVMDKVKKQRSTKNTHLN
KYQTIRKAGKVHYPIAWVNTMVFDYRGQLKTGDIILHCWSSFPDELEEMLNPIGTIQTNP
YTENATELHISFPEYSTQPVVFPAFDKILEKAAEIAGASDSMTMGRGGKKFYIELKEIME
RDPLSQLCENEKDLIWTLRYDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQIWPKLSP
RDALELLDFNYPDQYVREFAVICLRDMSDDELLQYLLQLVQVLRYEPYYDCALSRFLLER
AQSSRKIGHFLFWHLRSEMYMPAVSVHFALILEAYCRGCIPHIEVLKKQVEALNKLKAVS
ELIKLGTIKTKTKQAHLKEAMMTCLRQTGFIETLSDLQSPLNPNILLAGVHVERCKYMDS
KMKPLWIVYNNKLLGGDTVGIIFKNGDDLRQDMLTLQILRLMDLLWKEANLDLRIVPYGC
LATGDRSGLIEVVSSADTIANIQKTSSNMAAAAAFNKDALLNWLKDKNSGDALDKAIEEF
TLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIKRERVPFILT
HDFIHVIQQGKTGNTEKFGNFRQYCEEAYLILRKNGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKTDEEALKQFRQKFDEALRESWTTKVNWMAHIVAHPS
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgcctcccgccaagacagatcagctggacttgtgggcggagtcagggctggatggagac
gaccaggtgatggtcgacttcctgttgcccacaggaatatacatccagatggaggttcct
cgagagagcaccatccaacacatcaaactgctgttatggaaggaggcacagacataccct
ctcttctcattgctgggggagatggagggtcacatgttcgagtgtgtgaaccaggcagca
gtgcacgaagagctggaggatgaaaccaggcggctatgcgatgtgcgaccgttcctgcct
gtcctcaaactgatcacacgcaactgtggacgtgcagagcgcatactagactctaagatc
ggagtgctcattgggaaaggtcttcatgagttggatgccctgcaagaccagcaagtaaaa
gactttcgctccaaaatgaagcgagtcagcgaagagaagatgcagcgcatgcagctgatg
tcgtgtggagagtggcttcggagctgttactctacgcagctggggacagggtctttggag
aatttgattgacaaacatgagggtgtaatcaaaattaccatgcactatgaccagtcacag
gacacagccagcctgaaagtgtcattgcattgtacggtaactgaactaatggaccaggct
ctcaaaaaatggcagaccactcacggcccagaggaagacattggtacccgtagcgattat
gtgctgcgtgtcagtggcagatttgagttcctgtttgaagatcaccctcttaatcagtgc
aaatacattagggattgtttgttggccaatgagagccctcatctgacactggttcactgt
gacgttgtgaaggcaatgtttgagaaggaaatcagcacaattggatcagtgcttgcacgg
aaaacttcaaaccctcctctaccactgcccccaaagaagaggccgccaacgcagttacat
acgtgtgtttggaaggttcattctctgtttagaattaatcttgtgaaaggtaataaggtg
aacgctgaagatactgctaagatccaggttcgagcagggctctttcatggtacagagctg
ttgtgtaagacagcggtcagcagtgagagcagcagtcgatctgagcatgtgtggaacaaa
acgttggaatttgacatcgctgtttgtgacctgccccgaatggcccgcctctgttttgcc
atttacgctgttatggacaaagtgaagaaacagaggtcaaccaagaacacacacctgaac
aaataccagactatccgcaaggcggggaaagtgcactacccaatagcatgggttaacaca
atggtgtttgactacagagggcagctgaagactggtgacattatactccactgctggtcc
tcttttcctgatgagctggaagagatgttgaaccctattgggacaattcagaccaatcca
tacaccgagaatgccacagaactacatataagctttccagaatactcaacacaaccagtt
gtatttcctgcttttgacaagatcctggaaaaagctgcagaaatagctggagccagtgat
tccatgacaatgggtcgtgggggtaagaagttttacatagagctaaaggagatcatggag
agggatcctctctctcagctttgtgagaatgagaaagatctgatatggacacttcgctac
gactgcagagaaaactttcctcagtctctccccaaactactgctgtctgtcaaatggagc
aaacatgaagacatggctcagctacaggctttgctgcagatttggcccaaactaagccct
cgagatgccctagaacttctggatttcaactatcctgaccaatatgtcagagaatttgca
gtcatctgcctcagagatatgagtgatgatgagctgttgcagtatttactgcagcttgtg
caggtgttgcgctatgagccatactatgactgcgccctcagccgtttcctcctggaacgc
gctcagtccagccgtaagattggccacttcctcttctggcatctcaggtctgaaatgtac
atgccagccgtgtcggttcattttgctctgattttggaagcatactgccgaggctgcatc
ccacacatagaagttctcaaaaaacaggttgaagctctcaataagctgaaagctgtaagt
gagctgattaaattgggcaccataaaaactaagacaaaacaagctcatcttaaagaggcc
atgatgacttgccttagacagacgggattcatcgagacactttccgacctgcaatcacct
ctcaaccccaacatattgctcgctggagtacatgtggagaggtgtaagtacatggactct
aaaatgaaacctctgtggattgtttacaacaacaagctgttgggaggagacacagtgggc
atcatcttcaaaaatggagatgacctgcggcaggacatgttgactttacagatcttaagg
ttgatggatctgctatggaaggaggctaacttggacctcagaattgtgccttatggttgc
ttggcgacaggagatcgctctggtctgattgaggttgtgtcatcagctgataccattgcg
aacatccaaaaaacaagcagcaacatggccgccgctgctgccttcaataaagatgctcta
ctgaactggcttaaagacaagaactctggagatgctttggacaaagccattgaggagttc
actctgtcgtgtgctggttattgtgttgccacctacgtcttgggcattggtgatcggcat
agtgacaacatcatggttcgcagtacagggcagctcttccacatagacttcggccatatc
ctaggaaactttaagtccaagtttgggatcaagcgtgaacgtgttcctttcatcctcaca
catgacttcatccacgtgattcaacagggaaaaacaggcaacaccgagaaatttggaaat
tttaggcaatactgtgaggaggcgtatctgattctgagaaagaatggaaatctgttcatc
acactctttgctctgatgctcacagcaggcctgccagagcttacttctgtcaaagatatc
cagtatttaaaggactctctggcattaggtaaaactgatgaggaggccctcaaacagttc
cggcagaagtttgatgaagctctgcgagagagttggaccaccaaagtcaactggatggcc
cacattgtggctcacccttcataa

KEGG   Sinocyclocheilus rhinocerous: 107727530
Entry
107727530         CDS       T04916                                 

Gene name
pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107727530 (pik3r3)
   04370 VEGF signaling pathway
    107727530 (pik3r3)
   04068 FoxO signaling pathway
    107727530 (pik3r3)
   04070 Phosphatidylinositol signaling system
    107727530 (pik3r3)
   04150 mTOR signaling pathway
    107727530 (pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107727530 (pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    107727530 (pik3r3)
   04218 Cellular senescence
    107727530 (pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107727530 (pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107727530 (pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107727530 (pik3r3)
   04625 C-type lectin receptor signaling pathway
    107727530 (pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107727530 (pik3r3)
   04914 Progesterone-mediated oocyte maturation
    107727530 (pik3r3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107727530 (pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107727530 (pik3r3)
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107727530 (pik3r3)
SSDB
Motif
Pfam: SH2 PI3K_P85_iSH2
Other DBs
NCBI-GeneID: 107727530
NCBI-ProteinID: XP_016392908
LinkDB
Position
Unknown
AA seq 363 aa
MSSSSAEPFSYIEMSRVSAAGTVSSVNRGDDDASVFSEEISSDDHLLREMEPNDLLQEAE
WYWADISREEVNEVLHGMPDGAFLVRNASCKRQGEYTLTVRNNGTNKLIRIHHQDGKFGF
SEPLTFSSVPELISYYRHRSLVQYNSSLDVTLAYPVSHCDPLPTSSDLPVKEEFLSATRE
KLHECLRLFQKTAEYDQLYDACTTLLQEIQRRKTFEAVSMTETSEECCSQENSCKDFQDA
VQSELKESECEREKSVELLEEEESWFVGDLGRRQAEELLCGKPSGAFLIRNSSTKDCYAC
SVVVGSQVRHCVIRHTERGYGFVEPFDLHKSLKDLVMHYHHTSLAQHNQALDVRLAYPVH
AAN
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtcatcatcgtctgcagaaccgttttcctacatcgaaatgagtcgagtcagcgcagct
ggcactgtgtcaagcgttaatcgcggggacgacgacgcatcagtattcagtgaagaaatc
agtagcgacgatcatctcctcagagaaatggagcccaatgatttattacaggaggccgag
tggtactgggctgacatatccagggaggaggtgaatgaagttctccacggcatgcctgat
ggtgctttcctggtccgaaatgcttcctgcaagcggcagggagaatatacattaaccgtt
aggaacaatggcaccaacaaactcatcaggatccaccatcaagatggcaaatttgggttc
tccgagcctctgaccttcagctcagtgccggagctgatctcttactacaggcatcggagc
ttagtccagtacaacagctccctggatgtcacgctggcttatcccgtgtcccactgtgac
ccgcttcctacctcttctgatctgcctgtgaaggaagagtttttgagtgcaactagagag
aagctccatgaatgtttgagactgtttcagaagacggccgagtatgaccagctgtatgat
gcttgcactacgctgttacaggaaatccaaaggagaaaaacatttgaggccgtcagcatg
acagagacctctgaagagtgttgttctcaggagaactcttgcaaggatttccaagacgca
gtccagagtgagctgaaagagtctgaatgtgagcgtgagaagagcgtggagctgctggag
gaggaggagagctggtttgtgggagatctcggtcgacggcaggcagaggagcttctctgt
gggaaaccgtctggagctttcctcatccgcaacagcagcaccaaggactgttacgcctgc
tctgtggtggtcggcagccaggtgaggcactgcgtgattcgccacacggagcgcggctac
ggcttcgtcgagcccttcgatctccacaagtctctgaaggatctggtcatgcactaccat
cacacctcgctggcacagcacaaccaggcgctggacgtccggctggcgtatccggtccac
gccgctaactaa

KEGG   Sinocyclocheilus rhinocerous: 107730332
Entry
107730332         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107730332
   04370 VEGF signaling pathway
    107730332
   04068 FoxO signaling pathway
    107730332
   04070 Phosphatidylinositol signaling system
    107730332
   04150 mTOR signaling pathway
    107730332
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107730332
  09143 Cell growth and death
   04210 Apoptosis
    107730332
   04218 Cellular senescence
    107730332
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107730332
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107730332
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107730332
   04625 C-type lectin receptor signaling pathway
    107730332
  09152 Endocrine system
   04910 Insulin signaling pathway
    107730332
   04914 Progesterone-mediated oocyte maturation
    107730332
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107730332
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107730332
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107730332
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP AAA_13 SH3_1 SH3_2 Laminin_I SH3_9 Transcrip_act BRE1
Other DBs
NCBI-GeneID: 107730332
NCBI-ProteinID: XP_016396626
UniProt: A0A673KVR5
LinkDB
Position
Unknown
AA seq 727 aa
MSAEGYQYRALYNYKKEREEDIDLHVGDILTVNKGALLSVGYTEGMEERPDEIGWLPGFN
ESTQEKGDFPGTYVEFIGKKKISPPTPKPRPPRPLPVAPGPAMSDSDSEQSSSTLLDLTE
QFTPPEVAPPVLLKLLEAIESKGLDNPTLYRNFTAGGGLDVRQCFDSDPASVDLDQMDLQ
MLCDGLRRYLQDLPQPVIPSVVYSEMIRIAQEVQGTDECAHHLRLVASSSALPPQYWLTL
QSLLCHFSRVCQASAANLLSARALAEIFSPTLFRQQPTSCEPSPEAHIRIIEVLVTSEWS
DIQAAPALPPKPPKPTSVTNNGMNNNMVLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFDSVVELIDHYRHESLAQYNPK
LDVKLLYPVSKHQQDQVVKEDNVEAVGKKLHEYHQQYQEKNREYDRLYEEYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNEKEIQRIMVNYEKLKSRISEIV
DSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
IKNDNQDDQYSMVDDDEDLPHHDERSWKLGNINRNQAEALLRGKRDGTFLVRDSSKAGCY
ACSVVLDGEVKHCVINKTPTGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYP
VYAHQRR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagtgcagaaggatatcagtacagagcactgtataactataagaaagagagggaggag
gatattgacctgcatgtaggggacattcttacagtcaataaaggtgcgctactttcagtt
ggttacactgaggggatggaggagagaccagatgaaatcggatggctgcctggctttaat
gaaagcactcaggaaaagggggactttcctggtacgtacgtggagttcatcggcaagaaa
aagatttcaccaccaactcccaaaccaaggcccccaaggcctctaccggtagcccctggg
cccgcaatgtcagactcggactctgagcaaagctcgagcactctgttagacctgacggag
cagttcactcctccagaggtagctccgcctgtgctgctcaagctccttgaggccatcgag
agcaaaggtctagacaaccctacgctctacagaaacttcactgctggtggagggctggat
gtcagacaatgctttgatagtgaccctgcctcggtggatcttgatcagatggaccttcag
atgttgtgtgatggtctgaggaggtatcttcaagatctacctcagcctgtcattccctct
gtggtctacagtgagatgatacgcatcgctcaagaagtgcagggtacagacgaatgtgca
catcacctgcggctggtggccagctcctctgcacttcctccgcagtactggctaaccctg
cagagcttgctgtgccacttctcccgtgtatgccaggcctcagcggccaacctgcttagt
gctcgtgccctcgctgagatcttcagcccgacactcttcagacaacagcccaccagctgt
gagcccagcccagaggcacacattaggataattgaagtcctggtgaccagcgaatggagt
gacattcaggcggctccagcactacctcccaagccacccaaaccaacgtctgtcactaac
aacggtatgaacaacaacatggttctgcaagatgctgaatggtactggggggatatctcc
agggaggaggtcaacgaaaagcttagggacactgcagatggtacatttttggtccgagat
gcctccactaaaatgcatggggattacacactgacactgaggaaaggaggtaacaacaag
ctgatcaaaatcttccatcgtgatggaaaatacggcttttccgaccccctgaccttcgac
tctgtggttgagttgatcgaccactatcggcacgagtctctcgcccagtacaaccccaaa
ctagatgtgaaactactgtatcctgtgtccaagcaccaacaggatcaggtggtaaaggag
gacaacgttgaagctgttgggaagaagttgcacgaataccaccagcagtaccaagaaaag
aaccgagagtacgaccgactctatgaggaatacactagaacatcacaggaaatacaaatg
aaaaggactgccattgaagcttttaatgagaccataaagatctttgaagagcagtgccag
acgcaagaacggtacagcaaagaatatattgagaagtttaggagagaaggcaatgagaag
gaaatccaaaggattatggtcaactatgagaagttaaaatcccgcatcagtgaaattgtg
gacagcaaacggcgtctcgaagaagatctgaagaagcaggcggcagactacagagagatt
gacaagcggatgaacagcattaagcctgacctcatccagctcagaaagaccagggatcag
tacctcatgtggttgacacagaaaggggtccgtcagaagaaactcaacgaatggttggga
atcaaaaacgacaaccaggacgatcaatactcaatggtggatgacgatgaggatttgcca
caccatgacgaacgttcctggaagctcggtaacattaaccgcaaccaggcagaggccctt
ctgcggggcaagagagatggaacattcctggtcagggacagcagcaaagctggatgttat
gcgtgtagtgttgttctggatggtgaggtcaagcactgcgtcatcaacaagacacccaca
ggatatggcttcgctgagccctacaacctttacagctctctgaaagaactggtcttgcac
taccagcatacgtccctggttcagcacaatgactctttgaatgtcacgttagcataccca
gtctacgcacaccagaggcggtga

KEGG   Sinocyclocheilus rhinocerous: 107731623
Entry
107731623         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107731623
   04370 VEGF signaling pathway
    107731623
   04068 FoxO signaling pathway
    107731623
   04070 Phosphatidylinositol signaling system
    107731623
   04150 mTOR signaling pathway
    107731623
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107731623
  09143 Cell growth and death
   04210 Apoptosis
    107731623
   04218 Cellular senescence
    107731623
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107731623
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107731623
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107731623
   04625 C-type lectin receptor signaling pathway
    107731623
  09152 Endocrine system
   04910 Insulin signaling pathway
    107731623
   04914 Progesterone-mediated oocyte maturation
    107731623
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107731623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107731623
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107731623
SSDB
Motif
Pfam: SH2 PI3K_P85_iSH2 RhoGAP SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 107731623
NCBI-ProteinID: XP_016398233
LinkDB
Position
Unknown
AA seq 702 aa
MSSDSFQYRALFEYKQERGDDISLQPGDLLTVSKMALLTSDYQEGDEKCPKGWLHGTNER
TKEKGKFPGTFVEYVGVVRIGLTSGKPWPRPVPPTPVGPQPPGAAASEGPCGKGDVVEQC
ALPDQTPAVVLRLSEALERLDWENEPLYRSGQTSTGSPELLQALETDPAAVDFEQYELST
LADTLKSYIQDLPCLLIPAVVYSELVYTAQETQGMEECGQQLKRILDSPSVPQANHQLLV
HLTRHLSKVAQSGGAAQASPRLLALAYSEAIFKNNHFSADVNPEHHVKIIEALIMVGGLV
EIQAAPALPPKPTKPMTPVNGNGVKEAASGSLQEAEWYWGDISREEVNDKLRDMPDGTFL
VRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFSSVVELISHYRHESLAQY
NTKLDVKLMYPVSRYQQVNGFRLRAGVSHLQQSLPFLLPLSAHLLNNCTHPQCRGALWSA
TLICGLTNRSRFFFRIMMNYEKLKSRLGEIHDSKTRLEQDLKTQALDNRETDKKMNSLKP
DLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKNENTDDAYFVSEEDENLPHYDEKSWFV
GDLNRTQAEDLLHGKPEGAFLIRESSKKGCYACSVVVDGEVKHCVIYSTPRGYGFAEPYN
LYSTLKELVLHYHQTSLVQHNDSLNVRLAYPVYAQMPSGPRR
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgagctctgacagtttccagtaccgtgcactgtttgagtacaagcaggagaggggtgac
gatatctccctgcagcctggagatctcctcacagtcagtaagatggcactgctgacatcc
gattaccaggagggtgatgagaagtgcccaaaaggctggctgcatggcaccaatgaacgc
acaaaggagaagggcaagttccccggcacctttgtggagtatgttggggtcgtgaggata
ggccttacttcagggaagccctggccgagacctgtaccaccaacacctgtagggccccag
cccccaggggccgctgcttcagagggcccctgtggaaagggagatgttgtggagcagtgc
gctctgcctgaccagaccccagccgtggtgctcaggctgtcggaggctctagagaggctg
gactgggagaatgagccactgtaccggtctggccagacctccactggatccccagaatta
ttgcaggctttggaaacagacccagcagcggtggactttgagcaatatgaactgtccaca
ttggctgatacacttaagagttacattcaggacttgccctgcctgctcatcccagctgta
gtgtacagtgagctggtctacactgctcaggaaacccaaggcatggaggagtgtggacag
cagctgaaaagaatccttgactctcccagtgtccctcaggctaaccaccagctcctggtt
catctgacccgacacctaagtaaggtggcccaaagtgggggagcagctcaggcaagccct
aggcttctggctctggcctacagcgaggccatcttcaaaaacaaccacttcagtgcggat
gtaaacccagaacatcatgtaaagattattgaggcacttatcatggttggaggcctagtg
gagatacaagctgctccagctcttcctcccaagccaacaaaacccatgacaccagtaaat
ggcaacggtgtgaaagaagccgccagcggctcattgcaagaagcagaatggtactgggga
gacatatcaagggaagaggtgaacgacaaacttagagacatgcccgatggtactttcctg
gtacgggacgcctcgaccaagatgcagggagattacacactaacactaaggaaaggtgga
aacaataagctaataaagatctaccaccgggatgggaagtacggtttctcagacccgctc
acgttcagctcagtggtggagctcatcagtcactacaggcatgagtcactggcccagtac
aacaccaaactggacgtaaagctcatgtatcccgtctcccgctaccagcaggtaaatggg
tttagattgagggcgggggtatcacatttacagcaatcccttcctttccttttacctcta
tcagcgcacctcctaaataattgcacacatccacaatgtcgaggagcgctttggtcggca
accttgatctgtgggttgacaaatcgttctcgtttctttttcaggatcatgatgaactac
gagaagctcaaatcccgtcttggcgagattcacgacagtaagacccggcttgaacaggac
cttaaaacacaggctctggacaacagggagacggacaagaaaatgaacagcttaaagcca
gatctcattcagctcagaaagattagagatcagtaccttgtctggctcaatcataaaggt
gttcgacagaaacgaataaacgattggctggggatcaaaaacgagaacacggatgatgcc
tacttcgtcagtgaggaggatgagaatctgccacactacgatgagaagagctggtttgtg
ggggacctaaaccgaacgcaggctgaggacttgctacacggcaaacccgaaggagccttc
ctcatccgcgagagcagcaagaagggctgttatgcctgctctgttgttgtggacggcgag
gtgaagcactgcgtcatctacagcacaccccgcggctacggtttcgctgagccctacaac
ttgtacagcactctgaaagaattggtcctgcactatcaccagacctcactggtccagcac
aacgactcgctcaacgtgcggctggcgtacccagtgtatgcacagatgccctcaggccct
cggagatga

KEGG   Sinocyclocheilus rhinocerous: 107738919
Entry
107738919         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107738919
   04370 VEGF signaling pathway
    107738919
   04068 FoxO signaling pathway
    107738919
   04070 Phosphatidylinositol signaling system
    107738919
   04150 mTOR signaling pathway
    107738919
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107738919
  09143 Cell growth and death
   04210 Apoptosis
    107738919
   04218 Cellular senescence
    107738919
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107738919
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107738919
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107738919
   04625 C-type lectin receptor signaling pathway
    107738919
  09152 Endocrine system
   04910 Insulin signaling pathway
    107738919
   04914 Progesterone-mediated oocyte maturation
    107738919
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107738919
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107738919
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107738919
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_2 Laminin_I SH3_9 BRE1
Other DBs
NCBI-GeneID: 107738919
NCBI-ProteinID: XP_016406328
UniProt: A0A673NIA4
LinkDB
Position
Unknown
AA seq 727 aa
MSAEGYQYRALYDYKKEREEDIDLHVGDILTVNKGSLLAVGYTEGMEERPDEIGWLPGFN
ETTQEKGDFPGTYVEFIGKKKISPPTPKPRPQRPLPVAPGPARPDSDSEQSSSALVDLTE
QFTPPEVAPPMLLKLLEAIERKGLDNPTLYRNFTAGGGLDVRQCFDSDPASVDLEQMDLQ
MLYDGLRRYLQDLAQPVIPSVVYSEMIRIAQEVQGTDECAHHLRLVASSSALPPQYWLTL
QSLLRHFSRVCQASAANLLSARALAEIFSPALFRQQTTSCEPSPEAHIRIIEVLVTSEWS
DSQAAPALPPKPPKPTSVTNNGMNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRHESLAQYNPK
LDVKLLYPVSKHQQDQVVKEDNIEAVGKKLHEYHQQYQEKNREYDRLYEEYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNEKEIQRIMVNYEKLKSRISEIV
DSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
IKNDNQDDQYSMVDDDEDLPHHDERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKAGCY
ACSVVVDGEVKHCVINKTPTGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYP
VYAHQRR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagtgcagaaggatatcagtacagagcgctgtatgactataagaaagagagggaggag
gatattgacctgcatgtaggggacattcttacagtcaataaaggttcactactcgcagtt
ggttacactgaggggatggaggagagaccagatgaaatcggatggctgcctggctttaat
gaaactactcaggaaaagggggactttcctggtacgtacgtggagttcatcggcaagaaa
aagatttctccaccaactcccaaaccaagaccccaaaggcctttaccggtggccccaggg
cccgcaaggccagactcggactctgagcaaagctcgagcgctctggttgacctgacggag
cagttcacacctccagaggtagcaccgcccatgcttctcaagctcctcgaggccatcgag
cggaaaggtctagacaaccctacactctacagaaacttcactgctggaggagggctggat
gtcagacagtgctttgatagtgaccctgcctcggtggatcttgagcagatggaccttcag
atgttgtacgatggtctgaggaggtatcttcaagatctagctcagcctgtcatcccctct
gtggtctacagcgagatgatacgcattgctcaagaagtgcagggtacagacgaatgcgca
caccacctgcggctggtggccagctcctctgcacttcctccgcagtactggctgaccctg
cagagcttgctgcgccacttctcccgtgtatgccaggcctcagctgccaacctgcttagt
gctcgtgccctcgctgagatcttcagcccggcactcttcagacaacagaccaccagctgt
gagcccagcccagaggcacacattcggataattgaagtcctggtgaccagcgaatggagt
gacagtcaggcggctccagcactacctcccaagccacccaaaccaacgtctgtcactaac
aacggtatgaacaacaacatggctctgcaagatgctgaatggtactggggggacatctcc
agggaggaggtcaacgaaaagcttagggacactgctgatggtacatttttggtccgagat
gcctccactaaaatgcatggggattacacactgacattgaggaaaggaggtaacaacaag
ctgatcaaaatcttccatcgtgatggaaaatacggcttttcagaccccctaaccttcaac
tctgtggttgagttgatcaaccactatcggcacgagtctctcgcccagtacaaccccaaa
ctagatgtgaaactactgtatcctgtttccaagcaccaacaggatcaggtggtaaaggag
gacaatatagaagctgttggaaagaagttgcacgaataccaccagcagtaccaagaaaag
aacagagagtacgaccgactctatgaggaatacactagaacatcacaggaaatacaaatg
aaaaggactgctattgaagcttttaatgagaccataaagatctttgaagagcagtgccag
acgcaagaacggtacagcaaagaatatattgagaagttcaggagagaaggcaatgagaag
gaaatccaaaggataatggtcaactatgagaagttaaaatcgcgcatcagtgaaattgtg
gacagcaaacgtcgtcttgaggaagatctgaagaagcaagcggcagactacagagagatc
gacaagcggatgaacagcattaagcctgacctcatccagctcagaaagaccagggatcag
tacctcatgtggttgacacagaaaggggtccgacagaagaaactcaacgaatggttggga
atcaaaaacgacaaccaggacgatcaatactcaatggtggatgatgatgaagatttgcca
caccatgacgaacgctcctggaagctgggtaacattaaccgcatccaggcagaggccctg
ctgcggggcaagagagacggaacattcctggtcagggacagcagcaaagctggatgttac
gcctgtagtgttgttgtggatggtgaggtcaagcactgcgtcatcaacaagacacccaca
ggatatggcttcgctgagccctacaacctttacagctctctgaaagaactggtcttgcac
taccagcatacgtccctggttcagcacaatgactctttgaatgtcacgttagcataccca
gtctacgcacaccagaggcggtga

KEGG   Sinocyclocheilus rhinocerous: 107747314
Entry
107747314         CDS       T04916                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107747314
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107747314
   04370 VEGF signaling pathway
    107747314
   04068 FoxO signaling pathway
    107747314
   04070 Phosphatidylinositol signaling system
    107747314
   04150 mTOR signaling pathway
    107747314
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107747314
  09143 Cell growth and death
   04210 Apoptosis
    107747314
   04218 Cellular senescence
    107747314
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107747314
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107747314
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107747314
   04625 C-type lectin receptor signaling pathway
    107747314
  09152 Endocrine system
   04910 Insulin signaling pathway
    107747314
   04914 Progesterone-mediated oocyte maturation
    107747314
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107747314
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107747314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107747314
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107747314
Membrane trafficking [BR:srx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107747314
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_C2 PI3K_rbd RWD DUF4135
Other DBs
NCBI-GeneID: 107747314
NCBI-ProteinID: XP_016417264
UniProt: A0A673IBW2
LinkDB
Position
Unknown
AA seq 1067 aa
MPPAKTDQLDLWAESGLDGDDQVMVDFLLPTGIYIQMEVPRESTIQHIKLLLWKEAQTYP
LFSLLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLITRNCGRAERILDSKI
GVLIGKGLHELDALQDQEVKDFRSKMKQISEEKMQRMQLMSWGEWLRSCYSMPLEAGSLE
NLIDKHEGVIKITMHYDQSQDTASLKVSLHCTVTELMDQALKKWQTTHGPEEDIGFRSDY
VLHVSGKLEFLFEDHPLNQCKYIRDCLLTNESPHLTLVHCDGVKAMFEKEISTIGSVLAR
KTSNPPLPLPPKKRLPTQLHTCVWKVHSLFRINLVKGNKVNAEDAAKIQVRAGLFHGTEL
LCKTAVSSESSSRSEHVWNKTLEFDIAVCDLPRMARLCFAIYAVMDKVKKPRSTKNTHLN
KYQTIRKAGKVHYPIAWVNTMVFDYRGQLKTGDIILHCWTSFPDELEEMLNPIGTIQTNP
YTENATELHINFPEYSTQPVVFPAFDKILEKAAEIAGASDSMTMGRGGKKFYIELKEIME
RDPLSQLCENEKDLIWTLRYDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQIWPKLSP
RDALELLDFNYPDQYVREFAVYCLQDMSDDELLQYLLQLVQVLRYEPYYDCALSRFLLER
SQSSRKIGHFLFWHLRSEMFMPAVSVHFALILEAYCRGCIPHIEVLKKQVEALSKLKAVN
ELIKFGTIKTKTKQAHLKEAMMTCLRQTGFIETLSDLHSPLNPNILLAGINVERCKYMDS
KMKPLWIVYNNKLLEGDTVGIIFKNGDDLRQDMLTLQILRLMDLLWKEANLDLRIVPYGC
LATGDHSGLIEVVSSADTIANIQKTSSNMAAAAAFNKDALLNWLKDKNSGDALDKAIEEF
TLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGIKRERVPFILT
HDFIHVIQQGKTSNTEKFGNFRQYCEEAYLILRKNGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKTDEEALKQFRQKFDEALRESWTTKVNWMAHIVAHPS
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgcctcccgccaagacagatcagctggacttgtgggcggagtcagggctggatggagac
gaccaggtgatggtggacttcctgttgcccacaggaatatacatccagatggaggttcct
cgagagagcaccatccaacacatcaaactgctgttatggaaggaggcacagacataccct
ctcttctcattgctgggggagatggagggtcacatgttcgagtgtgtgaaccaggcagca
gtgcacgaagagctggaggatgaaaccaggcgactatgcgatgtgcgaccattcctgcct
gtcctcaaactgatcacacgcaactgtggacgtgcggagcgcatactagactctaagatc
ggagtgctcattgggaaaggtcttcatgaattggatgccctgcaagaccaggaagtaaag
gactttcgttccaaaatgaagcaaatcagcgaggagaaaatgcagcgtatgcagctgatg
tcatggggggagtggcttcggagctgttactccatgccgctggaggcagggtcattggag
aatttgattgacaagcatgagggcgtaatcaaaattaccatgcactacgaccagtcacag
gacacagccagcctgaaagtgtcattgcattgtacagtaactgaactaatggaccaggct
ctcaagaaatggcagaccactcacggcccagaggaagacattggtttccgaagtgattat
gtgctgcatgtcagtgggaaacttgagttcctgtttgaagatcaccctcttaatcagtgc
aaatacattagggattgtttgctgaccaatgagagccctcatcttacactggttcactgt
gatggtgtgaaggcaatgtttgagaaggaaatcagtacaattggatcagtgcttgcacgg
aaaacttcaaaccctcctctaccactgcccccaaagaagagactgccaacgcagttacat
acgtgtgtttggaaggttcattctctatttagaattaatcttgtgaaaggtaataaggtg
aacgctgaagatgctgctaagatccaggttcgagcagggctctttcatggtacagagctg
ctgtgtaagacggcagtcagcagtgagagcagcagtcgatctgagcatgtgtggaacaaa
acactggaatttgacatcgctgtctgtgacctgccacgaatggcccgcctctgttttgcc
atttacgctgttatggacaaagtgaagaaaccgaggtcaaccaagaacacacacctgaac
aaataccagactatccgcaaggcagggaaagtgcactacccaatagcatgggttaacaca
atggtgtttgactacagagggcagctgaagactggtgacattatcctccactgctggacc
tctttccctgatgagctggaagagatgttgaaccctattgggacaattcagaccaatcca
tacacagaaaatgccacagaactacatataaactttccagaatactcaacacaacctgtt
gtatttcctgcttttgacaagatcctggaaaaagctgcagaaatagctggagccagtgat
tccatgacaatgggtcgtgggggtaagaagttttacatagagctaaaggagatcatggag
agggatcctctctctcagctttgtgagaacgagaaagatctgatttggacgcttcgctac
gactgcagagaaaactttcctcagtcactccccaaactgctgctgtctgtcaaatggagc
aaacatgaagacatggcccagctacaggctttgttgcagatttggcctaaactaagccct
cgagatgctctagaacttctggatttcaactaccctgaccaatatgtcagagaatttgcg
gtctactgccttcaagatatgagcgatgatgagctgttgcagtatttactgcagcttgta
caggtgttgcgctatgagccatactatgactgtgcccttagccgtttcctcttggagcgc
tctcagtccagccgcaagattggccatttcctcttctggcatcttaggtctgaaatgttc
atgccagctgtgtcagtccattttgctctgattttggaagcatactgcagaggctgcatc
ccacacatagaagttctcaaaaaacaggttgaagctctcagtaagctgaaagcagtaaat
gagctgattaaatttggcacaataaaaactaagacaaaacaagctcatcttaaagaggcc
atgatgacctgccttagacagacgggattcattgagactctttctgacctgcattcacct
ctcaaccccaacatattgctcgctggaataaatgtggagaggtgtaagtacatggattct
aaaatgaaacctctgtggattgtttacaataacaagctgttggaaggagacacagtgggc
atcatcttcaaaaatggagatgacctgcggcaggacatgttgactctacaaatcttgagg
ttgatggatctgctgtggaaggaggctaacctggacctcagaattgtgccttatggttgc
ttggcgacaggagatcactctggtctgattgaggttgtgtcatcagctgataccattgcg
aacatccaaaaaacaagcagcaacatggccgctgctgctgccttcaataaagatgctcta
ctgaactggcttaaagacaagaactctggagatgctttagacaaagccattgaggagttc
actttatcgtgtgctggatattgtgttgccacctacgtcttgggaattggtgatcggcat
agtgacaacatcatggttcgcagtacagggcagctcttccacatagactttggccatatc
ctaggaaactttaagtccaagtttgggatcaagcgtgagcgtgttcctttcatcctcaca
catgacttcatccatgtgattcaacagggaaaaacaagcaacactgagaaatttggaaat
tttaggcaatactgtgaggaggcatatctgattctgagaaagaatggaaatctgttcatc
acactctttgctctgatgctcacagcaggcctgccagagcttacgtctgtcaaagacatc
cagtatttaaaggactctctggcattaggtaaaactgatgaggaggccctcaaacagttc
cggcagaagtttgatgaagctctgcgagagagttggaccaccaaagtcaactggatggcc
cacattgtggctcatccttcataa

DBGET integrated database retrieval system