KEGG   Sinocyclocheilus rhinocerous: 107708991
Entry
107708991         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3-like
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107708991
   04310 Wnt signaling pathway
    107708991
   04370 VEGF signaling pathway
    107708991
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107708991
   04520 Adherens junction
    107708991
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107708991
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:srx04031]
    107708991
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107708991
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107708991
NCBI-ProteinID: XP_016368870
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIERLRDKKLSPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRGKRCTLF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagctattaaatgcgtggttgtcggcgacggggcggtgggtaaaacctgtctgctg
atcagctacaccacaaatgccttccctggcgagtacatccctacagtatttgacaactac
tctgccaatgtgatggtcgatggcaaaccggtcaaccttggcttatgggatacagcagga
caggaagactatgatcgcctccgtcccctctcgtacccacagacggatgtgtttttaata
tgcttctcattggtgagcccagcatcttttgagaacgtccgtgcaaagtggtaccccgag
gtgcgacatcactgccccaacacacccatcatcctggtgggcaccaaactggatctgcga
gatgataaggacaccatagagaggctgcgggacaaaaagctgtcgcccatcacctaccct
cagggtctggccatggcccgagagatcggtgctgtgaagtatctggaatgctctgctctg
actcagcgcggtctaaagactgtatttgacgaggccatccgtgccgtcctctgccctcca
cccgtcaaaaaacgcggcaagcgctgcactctcttctga

KEGG   Sinocyclocheilus rhinocerous: 107719987
Entry
107719987         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107719987
   04310 Wnt signaling pathway
    107719987
   04370 VEGF signaling pathway
    107719987
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107719987
   04520 Adherens junction
    107719987
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107719987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:srx04031]
    107719987
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107719987
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107719987
NCBI-ProteinID: XP_016383031
UniProt: A0A673IGD3
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRGKKCTVF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagccattaagtgtgttgttgtcggcgacggtgccgtgggtaagacatgcctgctc
atcagctacaccactaatgccttcccaggagagtatattcccacagtatttgacaactac
tctgccaatgttatggtggatggcaagcctgttaacttaggcctctgggatacagcagga
caggaggactatgatcgccttagaccactctcctatccccaaacagatgtgtttttaatt
tgcttctctctggtgagccccgcttcctttgagaatgtaagagcaaagtggtaccctgag
gttcgccatcactgtccaaacacccccatcatacttgtgggcactaaacttgatctgcga
gatgacaaagacacgattgaacgcctgcgggataagaaactagctcccatcacttatcca
caaggtcttgctatggctagagagattggtgctgtgaaatatctggagtgctctgctctt
acacagcggggtttaaaaaccgtgtttgatgaggccatccgtgctgttttatgtcctcca
cctgtaaagaaaaggggcaagaagtgtactgtattttga

KEGG   Sinocyclocheilus rhinocerous: 107720282
Entry
107720282         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3-like
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107720282
   04310 Wnt signaling pathway
    107720282
   04370 VEGF signaling pathway
    107720282
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107720282
   04520 Adherens junction
    107720282
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107720282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:srx04031]
    107720282
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107720282
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 107720282
NCBI-ProteinID: XP_016383446
LinkDB
Position
Unknown
AA seq 122 aa
MSRKQDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIERLR
DKKLSPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRGKRCT
LF
NT seq 369 nt   +upstreamnt  +downstreamnt
atgagtaggaaacaagatgtgtttttaatatgcttttcattggtgagcccagcgtccttt
gagaacgtccgtgcaaagtggtaccccgaggtgcgacaccactgccccaacacacccatc
atcctggtgggcaccaaactggacctgcgggatgataaggacaccatagagcggctgcgg
gacaagaagctgtctcccatcacatacccgcagggtctggccatggcccgagagatcggg
tctgtgaagtatctggagtgctctgctctgacgcagcgcgggctaaagactgtgtttgac
gaagccatccgcgccgtcctctgccctccacctgtcaaaaaacgcggcaaacgctgcact
ctcttctga

KEGG   Sinocyclocheilus rhinocerous: 107721474
Entry
107721474         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107721474
   04310 Wnt signaling pathway
    107721474
   04370 VEGF signaling pathway
    107721474
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107721474
   04520 Adherens junction
    107721474
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107721474
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:srx04031]
    107721474
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107721474
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107721474
NCBI-ProteinID: XP_016384967
UniProt: A0A673IGD3
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRGKKCTVF
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagccattaagtgtgtcgttgtcggcgacggtgccgtgggtaagacatgcctgctc
atcagctacaccactaatgccttcccaggagagtatattcccacagtatttgacaactac
tctgccaatgttatggtggatggtaaacctgtcaacttaggcctctgggatacagcagga
caagaggactatgatcgccttagaccactctcctatccccaaacggatgtgtttttaatt
tgcttctcactggtgagccctgcttcctttgagaatgtaagagcaaagtggtacccagag
gttcgccatcactgtccaaacacccccatcatacttgtgggcactaaacttgatctgcga
gatgacaaagacacgattgaacgtctgcgggataagaaactagctcccatcacttatccg
caagggcttgctatggctagagagattggtgctgtgaagtatctggagtgctctgctctt
actcaacggggtttaaaaaccgtgtttgatgaggccatccgcgctgttttatgtcctcca
cctgtaaagaaaaggggcaagaagtgtactgtattttga

KEGG   Sinocyclocheilus rhinocerous: 107729213
Entry
107729213         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04145  Phagosome
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107729213
   04310 Wnt signaling pathway
    107729213
   04370 VEGF signaling pathway
    107729213
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107729213
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107729213
   04520 Adherens junction
    107729213
   04530 Tight junction
    107729213
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107729213
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107729213
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107729213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107729213
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107729213
   04031 GTP-binding proteins [BR:srx04031]
    107729213
Membrane trafficking [BR:srx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107729213
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    107729213
  Macropinocytosis
   Ras GTPases
    107729213
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107729213
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107729213
  Exosomal proteins of other body fluids (saliva and urine)
   107729213
  Exosomal proteins of colorectal cancer cells
   107729213
  Exosomal proteins of bladder cancer cells
   107729213
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107729213
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107729213
NCBI-ProteinID: XP_016395132
UniProt: A0A673KLN5
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENLRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKERRRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtcgtcggggacggagctgtgggtaaaacatgcctgctg
atcagctacacaaccaatgcctttcctggagaatacatccccacagtatttgataattac
tctgcaaatgtgatggtggatgggaaaccagtgaatctgggtctctgggatacagcagga
caggaggattatgacagactgcgtcccctgtcgtaccctcaaacggacgtgtttctcatc
tgcttctcccttgtgagtcctgcctcttttgagaaccttcgtgcaaagtggtatccagaa
gtgaggcaccactgtccaaacacgccaatcatcctggtaggaaccaagcttgatctgaga
gacgataaggacactattgagaaactgaaggagaagaagctcactcccatcacctaccct
cagggcctggccatggccaaagagattggagctgtgaagtatctggagtgctcagcgctc
acacagcgcggccttaagacggtgtttgacgaggccatccgtgccgtgctctgccctccc
ccagtcaaggagaggaggaggaaatgcctgctgctctag

KEGG   Sinocyclocheilus rhinocerous: 107732889
Entry
107732889         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 isoform X1
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107732889
   04310 Wnt signaling pathway
    107732889
   04370 VEGF signaling pathway
    107732889
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107732889
   04520 Adherens junction
    107732889
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107732889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:srx04031]
    107732889
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107732889
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107732889
NCBI-ProteinID: XP_016399810
UniProt: A0A673N750
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTKVKKKGCVLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagcaataaagtgcgtggtggtcggagatggagctgtgggaaagacctgtcttctc
atcagctacactaccaatgctttccctggggagtacatacccacagtgtttgataactac
tcagcaaatgttatggtggatagcaaaccagtcaatctgggcctttgggatacagctgga
caggaagactatgacagactgcggccactgtcctaccctcagacggatgtgtttctcatc
tgtttctctttggtgagcccagcatcgtttgaaaacgtcagagccaagtggtacccagag
gtgaggcaccactgcccttctactccaattattctggttggcaccaagctcgatttgaga
gatgagaaggagaccatcgagaagctgaaggagaaaaaactggcaccaatcacttaccca
cagggtctcgcattggccaaagaaatagatgcagtaaaatacctggagtgctctgctctc
actcagagaggtctaaagacagtgtttgatgaggccattcgtgctgttctctgcccacag
cccaccaaggtcaagaagaagggctgtgtgctgctttaa

KEGG   Sinocyclocheilus rhinocerous: 107733870
Entry
107733870         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2-like
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107733870
   04310 Wnt signaling pathway
    107733870
   04370 VEGF signaling pathway
    107733870
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107733870
   04520 Adherens junction
    107733870
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107733870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:srx04031]
    107733870
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107733870
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107733870
NCBI-ProteinID: XP_016401186
UniProt: A0A673KKF2
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAPITYPQGLALAKEVDAVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTKVKKKGCVLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagcaataaagtgtgtggtggtcggagatggagctgtgggaaagacctgtcttctc
atcagctacactaccaatgctttccctggggagtacattcccacagtgtttgataactac
tcagcaaatgttatggtggatagcaaaccagtcaacctgggcctttgggatacagctgga
caggaagactacgacagactgcggccactgtcctaccctcagacggatgtgtttctcatc
tgtttctctctggtgagcccagcatcgtttgaaaacgtcagagccaagtggtacccagag
gtgaggcaccactgcccttccactccaattattctggtcggcaccaagctcgatttgaga
gatgagaaggagaccatcgagaagctgaaggagaaaaaactggctccaatcacttaccca
cagggtcttgcattggccaaagaagttgatgcagtaaaatacctggagtgctctgctctc
actcagagaggtctgaagacagtgtttgatgaggccattcgtgctgtgctctgcccacag
cccaccaaggtcaagaagaagggctgtgtactgctttaa

KEGG   Sinocyclocheilus rhinocerous: 107736604
Entry
107736604         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04145  Phagosome
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107736604
   04310 Wnt signaling pathway
    107736604
   04370 VEGF signaling pathway
    107736604
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107736604
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107736604
   04520 Adherens junction
    107736604
   04530 Tight junction
    107736604
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107736604
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107736604
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107736604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107736604
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107736604
   04031 GTP-binding proteins [BR:srx04031]
    107736604
Membrane trafficking [BR:srx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107736604
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    107736604
  Macropinocytosis
   Ras GTPases
    107736604
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107736604
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107736604
  Exosomal proteins of other body fluids (saliva and urine)
   107736604
  Exosomal proteins of colorectal cancer cells
   107736604
  Exosomal proteins of bladder cancer cells
   107736604
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107736604
SSDB
Motif
Pfam: Ras Roc CagD Arf
Other DBs
NCBI-GeneID: 107736604
NCBI-ProteinID: XP_016403471
LinkDB
Position
Unknown
AA seq 123 aa
AFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVS
PASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMA
KEI
NT seq 370 nt   +upstreamnt  +downstreamnt
gcctttcctggagaatacatccccacagtatttgataattactctgcaaatgtgatggtg
gatgggaaaccagtgaacctgggtctctgggatacagcaggacaggaggattatgacaga
cttcgtcctctgtcgtaccctcaaacggacgtgtttctcatctgcttctcccttgtgagc
cctgcctcttttgagaatgttcgtgcaaagtggtatccagaagtgagacaccactgtcca
aacactccaatcatcctggtaggaaccaagcttgatctgagagatgacaaggacaccatt
gagaaactgaaggagaagaagctcactcccatcacctaccctcaaggcctggccatggcc
aaagagatcg

KEGG   Sinocyclocheilus rhinocerous: 107745654
Entry
107745654         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04145  Phagosome
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107745654
   04310 Wnt signaling pathway
    107745654
   04370 VEGF signaling pathway
    107745654
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107745654
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107745654
   04520 Adherens junction
    107745654
   04530 Tight junction
    107745654
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107745654
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107745654
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107745654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107745654
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107745654
   04031 GTP-binding proteins [BR:srx04031]
    107745654
Membrane trafficking [BR:srx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107745654
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    107745654
  Macropinocytosis
   Ras GTPases
    107745654
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107745654
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107745654
  Exosomal proteins of other body fluids (saliva and urine)
   107745654
  Exosomal proteins of colorectal cancer cells
   107745654
  Exosomal proteins of bladder cancer cells
   107745654
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107745654
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107745654
NCBI-ProteinID: XP_016415063
UniProt: A0A673LCR2
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKGKRRCFIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccataaagtgtgtggtcgtcggggacggggctgtgggaaaaacatgccttctg
atcagctacaccaccaatgcttttcccggggaatacatccctactgtatttgataattat
tctgctaatgtgatggtcgatggaaagccggtgaatctgggactgtgggatacagcaggg
caggaggattacgacaggcttcgaccgctctcctaccctcagacggatgtgttcttgatt
tgtttctctcttgtgagtccagcctcgtttgagaacgtccgtgcgaagtggtatccagag
gtcagacatcattgtcccaacactccgataattctggttgggactaagcttgacctgaga
gacgacaaggacactatagaaaagttgaaagagaagaaactcacacccatcacctaccct
caaggtctcgctatggccaaagaaataggagctgtgaagtacctggaatgctcagcctta
acgcaacgcggccttaagacggtgttcgatgaagccatccgtgcggtcctgtgtccgccc
ccagtcaagaaaggaaagaggaggtgttttatcctctga

KEGG   Sinocyclocheilus rhinocerous: 107752410
Entry
107752410         CDS       T04916                                 

Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04145  Phagosome
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04520  Adherens junction
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107752410
   04310 Wnt signaling pathway
    107752410
   04370 VEGF signaling pathway
    107752410
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107752410
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107752410
   04520 Adherens junction
    107752410
   04530 Tight junction
    107752410
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107752410
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107752410
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107752410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107752410
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107752410
   04031 GTP-binding proteins [BR:srx04031]
    107752410
Membrane trafficking [BR:srx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107752410
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    107752410
  Macropinocytosis
   Ras GTPases
    107752410
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107752410
Exosome [BR:srx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107752410
  Exosomal proteins of other body fluids (saliva and urine)
   107752410
  Exosomal proteins of colorectal cancer cells
   107752410
  Exosomal proteins of bladder cancer cells
   107752410
GTP-binding proteins [BR:srx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107752410
SSDB
Motif
Pfam: Ras Roc
Other DBs
NCBI-GeneID: 107752410
NCBI-ProteinID: XP_016423856
LinkDB
Position
Unknown
AA seq 196 aa
MGNAQQEIIKHLCPFFCPFRHIVFSQGDIKEDYDRLRPLSYPQTDVFLICFSLVDSDSLE
NVSEKWYPEVRHHCPDARIILVGTKLDLRDDKDTIEKLKKKKQTPITYHQGLAVAERIGA
VKYLKCSALTQKGLKMVFDEAVLAVLDPSPVKKRERKTDDSLDDDTADFTETVEANVPNC
VEASKQLDTRLHCDTK
NT seq 591 nt   +upstreamnt  +downstreamnt
atgggaaatgctcagcaggaaatcatcaaacacctctgtcctttcttctgtccgttcagg
catattgttttctctcagggggatataaaggaggattacgacagacttcgacctctttct
taccctcagacggatgtgttcttgatctgtttctctctcgtggattcagactcattagaa
aatgttagtgaaaagtggtatccagaggtcaggcatcattgccctgacgctcggatcatt
ctagtcgggactaaacttgatctgagagacgacaaggacaccattgaaaagctgaaaaag
aagaaacaaacccccatcacctatcatcaaggcctggctgtggctgaacgaataggagct
gtgaagtacctgaagtgctcagcattaacacagaagggccttaagatggtgtttgatgaa
gctgtcctggcggtcctggatccgtccccagtgaagaaaagagagagaaagactgatgac
tccctggatgatgataccgcagacttcactgaaacagttgaagcaaatgtgccgaattgt
gtcgaggcttcgaaacaattagacacccgtctccactgtgacaccaagtag

DBGET integrated database retrieval system