KEGG   Sinocyclocheilus rhinocerous: 107709740Help
Entry
107709740         CDS       T04916                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial-like isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107709740
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107709740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 EF-hand_8 FAD_oxidored GIDA Pyr_redox_2 EF-hand_9 NAD_binding_8 Thi4 EF-hand_5 HI0933_like Pyr_redox_3 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 107709740
NCBI-ProteinID: XP_016369824
LinkDB All DBs
Position
Unknown
AA seq 729 aa AA seqDB search
MAFRKAVKGTLIGGGAIATAFGLSQFFEYRNNQPKWARLAYVEAQGELKVPFKDALPTRE
EQLSTLRNTEVFDVLVVGGGATGSGCALDAVTRNLKTALVERSDFSSGTSSRSTKLIHGG
VRYLQKAIMKLDYEQYMMVKEALHERANLLNIAPHLSAPLPIMLPVYKWWQLPYYWAGIK
MYDLVAGSQCLKSSYVLSKSKALELFPMLKKDKLVGAIVYYDGQHNDARMNLAIALTAAR
HGAAIANYTEVVHLLKKPDPKTGQEKVCGAHCRDIITGQEFDVRARCVINATGPFTDSLR
KMDNQKTANICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTVAGTTDTP
TEVTAHPIPVEDDINFILSEVRNYLSPDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSICR
NHIVNISDSGLITIAGGKWTTYRSMAEETLDAAIKAHNLSAGPSRTVGLMLDGGKDWTPT
LYIRLVQDYGLENEVAQHLAATYGGRAFEVAKMAKVTGKRWPIVGKRLVSEFPYIESEVQ
YAVKEYACTAIDVIARRTRLGFLNVQAADEALPRIVEIMGNELQWTEQKKKEELEAAKKY
LHLEMGYKARSEQLSKTTEISLTAPEIARYKKRFYKFDKESKGFITTVDVQQVLEKLSIQ
IDENALHEILNEVDLNKNGQVELDEFLQLMSAVQRGQISDSRLAILMKTVEEGLDLRGPV
SVDRSGGGV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggctttcagaaaggcagtgaagggaaccctaatagggggcggagctatagcaacagcc
ttcggcctatcacagttctttgaatacaggaataatcagccgaaatgggctcggctggca
tatgttgaagcacagggtgagctaaaggtgccgtttaaagatgctctcccaacaagagag
gagcagctttcaacactgcgaaacacagaggtgtttgatgtcttggtggtgggcggcgga
gccacgggctcgggatgtgccttagacgctgtcacacggaatctgaagaccgccctggta
gaacggagcgatttttcatcgggcaccagcagcagaagcaccaagctcattcacggcgga
gtccgctatctgcagaaagccatcatgaaactagattatgagcagtacatgatggtgaaa
gaggcccttcatgaacgtgccaacttgctgaacatcgctccccacctgtctgcaccttta
cctataatgcttcctgtttacaagtggtggcagctgccgtattactgggctggcattaaa
atgtacgacctggttgctggatcacagtgtctgaagagcagctacgtcctgagcaagagc
aaagcactggagctcttccctatgctgaagaaagacaaacttgtgggagccattgtctac
tatgatggacaacacaatgacgcccgtatgaacctggccatcgctcttacagcggcccgt
catggtgctgctattgctaactacacagaggtggttcatctgctaaagaaaccagaccca
aaaacaggccaagagaaagtttgtggagcccactgccgagacataatcacagggcaggag
tttgacgttcgtgccagatgtgtcattaacgctaccggccccttcactgactccctgcgc
aaaatggacaaccagaaaactgccaacatctgccagcctagtgcaggagtgcacattgtc
atccctggatattacagcccggacaacatggggctgttagaccccgccaccagtgatggc
cgtgtcatattcttcctgccctgggagaagatgactgttgccggcacgacagacacgccc
actgaagtcacagcccatcccatcccagtggaggatgacatcaactttatcctgagcgaa
gtacgcaattacctcagccctgacgtagaagtgcggcggggggatgtcctggcggcctgg
agtggcattcgtccgctggtcaccgaccccaactccaaagacacgcagtccatctgtcgt
aaccacatcgtcaacatcagcgacagcggactcatcaccattgctggtgggaagtggaca
acctatcgttctatggctgaggagactcttgacgcagctataaaggctcataacctctca
gccggtcccagcaggacggtcggtctgatgctggatggtgggaaggactggacccccacc
ctgtacattcgcttggttcaagactacggcttggaaaacgaggttgctcagcacctggca
gccacctatggaggaagagcatttgaagtggccaaaatggccaaggtgacaggcaagaga
tggcctatagtggggaaacgccttgtgtctgaatttccctacatagagagtgaggtgcag
tatgctgtaaaggagtacgcatgtacagccatcgatgtgattgctcgccgaactcgactg
ggctttctgaacgtgcaggctgcggatgaggctttgccacgtattgttgagatcatgggc
aacgaactgcagtggactgagcaaaaaaagaaagaagagctggaggcagcaaagaagtat
ctgcacctggagatgggttataaagctcgctctgagcagctcagcaagacaacagagatc
tcactcactgccccagagatagcaaggtataagaagcgcttttacaagtttgataaggag
agtaaaggctttatcacaacagtggatgtccagcaagtgctagagaaactcagcattcag
attgatgagaacgcccttcatgagatcctcaacgaggtggacctcaacaaaaacgggcag
gtggaactggatgagttcttgcagctcatgagtgcagtccagagaggccaaatctctgac
agtcgtctggctatcctgatgaagacggtcgaggaggggttggatctgagaggacctgtc
tcagttgaccgcagtggaggcggtgtttga

DBGET integrated database retrieval system