KEGG   Sinocyclocheilus rhinocerous: 107710001
Entry
107710001         CDS       T04916                                 

Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107710001
   04012 ErbB signaling pathway
    107710001
   04310 Wnt signaling pathway
    107710001
   04370 VEGF signaling pathway
    107710001
   04020 Calcium signaling pathway
    107710001
   04070 Phosphatidylinositol signaling system
    107710001
   04150 mTOR signaling pathway
    107710001
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107710001
   04540 Gap junction
    107710001
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107710001
   04916 Melanogenesis
    107710001
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107710001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107710001
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107710001
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107710001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C CEP76-C2 C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107710001
NCBI-ProteinID: XP_016370162
UniProt: A0A673MYG2
LinkDB
Position
Unknown
AA seq 670 aa
MAEQSNSDGEEGSAPMRGFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAK
NLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLS
VEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEEL
RQKFERAKIGPSKIDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKG
GDELFAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFVMEYI
SGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHVKGIIYRDLKLDNVMLDMEGHIKIA
DFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDG
EDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYM
DWEKLENKEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFIN
PEYPAMEAQS
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcagagcaatcgaacagcgatggagaggaggggagcgcacccatgaggggctttgcc
cgacaaggtgctctgagacagaagaacgttcacgaagttaaggaccacaagtttatcgct
cgcttcttcaagcagcctactttctgcagccactgcacggactttatctggggttttggg
aaacaaggatttcagtgtcaagtctgctgctttgtggtgcacaagcgttgccatgaattc
gtcaccttctcctgccccggagcagataagggtcctgcatcagatgacccgcgcagtaag
cacaagttcaaggtccacacgtactccagcccaaccttctgtgaccactgcggctctctg
ctgtatggactcatccaccagggcatgagatgtgaccactgcatgatgaacatccataag
cgctgtgtggccaacgtgccgagtctgtgtgggactgaccacactgagaggaggggccgc
atccaaatcactgcagagatcaagaacaatgtgctcaccgtcagcattaaagaggcgaag
aacctggtgcccatggaccctaatggactctctgacccctacgtcaaactaaaactcatc
cctgaccccaagagcgagagcaaacagaagaccaagaccatcaagtgctgcctgaatccc
acatggaacgagaccttcacattcaatctgaaggagtctgacaaggaccgcaggctgtct
gtggagatctgggactgggacttgaccagccggaacgactttatgggctctctgtctttc
ggcatctcggagcttcagaagcaaggggtggacggatggtttaagctgctcagtcaggaa
gagggcgagtacttcaacgtacctgtcccacctgaaggagaagaaggcaatgaggaactc
cggcagaagtttgagagagctaaaattggtcccagcaaaatagatggctcttcctccaac
gccatctccaaattcgacagcaatggcaaccgggaccgcatgaaactgtccgacttcaat
tttctcatggtgttgggcaagggtagctttggaaaggtgatgctggccgagagaaaggga
ggtgatgagctgtttgccgtaaagatcctgaagaaggacgtggtgatccaggatgatgat
gttgaatgcactatggtggagaagagagtgttggccttgtcaggaaaaccacccttcctc
actcacctgcactcctgctttcagaccatggaccgcctgtactttgtcatggaatacatc
agtggtggggatctcatgtatcatatccagcaggtcggcaagtttaaggaaccccatgct
gtgttttatgctgcagaaatcgccataggcctgtttttcctgcatgtgaagggtattata
tacagagatctaaagttggataatgtcatgttggacatggagggtcatatcaaaattgct
gactttggaatgtgcaaggagaacatgcttgatggagtcaccaccaagaccttttgtggg
acacctgactacatcgcccctgagatcatcgcttaccagccttatggaaagtcagtggac
tggtgggcttttggagttctgctctatgagatgctggctgggcagcccccatttgatggt
gaggatgaggatgagctgtttcagtccatcatggagcatcatgtgtcctatcccaaatcc
atgtccaaagaagctgtggccatctgcaaagggctgatgaccaaacacccaggcaagcgt
ctgggctgcggtcctgagggtgagcgggacatcagggaacacggctttttccgttacatg
gattgggaaaagttggagaacaaggaagttcagccaccgtttaaaccaaaagcctgtggc
cgggatgcagagaactttgaccgctttttcacccgccatccaccggttctcacccctcca
gaccaggaggtcatcatgaacctcgaccaagacgagttcgagggcttttccttcataaac
cccgaataccctgccatggaagcccagagttaa

KEGG   Sinocyclocheilus rhinocerous: 107710161
Entry
107710161         CDS       T04916                                 

Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107710161
   04012 ErbB signaling pathway
    107710161
   04310 Wnt signaling pathway
    107710161
   04370 VEGF signaling pathway
    107710161
   04020 Calcium signaling pathway
    107710161
   04070 Phosphatidylinositol signaling system
    107710161
   04150 mTOR signaling pathway
    107710161
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107710161
   04540 Gap junction
    107710161
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107710161
   04916 Melanogenesis
    107710161
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107710161
   04270 Vascular smooth muscle contraction
    107710161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107710161
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107710161
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107710161
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107710161
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107710161
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107710161
NCBI-ProteinID: XP_016370380
UniProt: A0A673HGP6
LinkDB
Position
Unknown
AA seq 671 aa
MADIIQSNEQSSSDVANRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSL
LYGLIHQGMKCDSCDTNVHKQCVMNVPSLCGMDHTERRGRLYLKIEVIEEKMHVTVGEGK
NMIPMDPNGLSDPYVKLKLIPDPKNETKQKTKTIRSSLNPAWNESFTFKLKPADKDRRLS
VEVWDWDRTTRNDFMGSMSFGVSELKKSSVCGWYKVLNQEEGEYYNVPIPDEDDENTELR
QKFEKAKLGPSKRATTPLDDSGSTLPSSSMDRVKLTDFNFLAVLGKGSFGKVMLAEMKST
GELFAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVN
GGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHKKGVIYRDLKLDNVMLDAEGHIKIAD
FGMCKENIVEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTKHSSKRLGCSPEGERDIREHAFFRRID
WERLENREIQPPFKPKVCGKGAENFDKFFTRTQPQLTPPDELVIANIDQAEFDGFSFINL
QFIHPSIINSE
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgatatcatacaaagcaacgagcagtcctcatctgacgttgcaaatcgattcgcc
cgtaaaggtgctttgaggcagaaaaacgtccatgaagtgaaaaaccacaaatttattgcg
aggtttttcaagcagccgactttctgcagtcactgcactgactttatttgggggtttggg
aagcaaggatttcagtgccaagtgtgctgctttgtggtccataaacgttgccatgaattt
gtcacattctcatgccctggagctgataaagggccagacacagatgaccctaggagcaag
cacaaatttaagatccacacctatggcagtcccacattctgtgaccactgtggatctctt
ctatatggactcatacaccaaggaatgaaatgtgactcctgtgatacgaacgtccataag
cagtgtgtgatgaacgtgccaagcctttgtggaatggaccacacagagagacgaggacgt
ctttacttgaagatcgaggtgatagaagaaaaaatgcatgtcacagtgggggaaggcaag
aacatgattccaatggacccgaatggattgtctgatccatatgtaaaactcaagttgatt
ccagaccctaaaaatgagacaaaacagaaaacgaaaaccatccgttcttccctgaatccg
gcttggaacgagtcatttacatttaaactgaagccagcagataaggaccgtcggctgtct
gtggaggtgtgggactgggacagaaccacccgtaatgatttcatgggctcaatgtctttt
ggtgtgtctgagctcaagaaatcctcagtgtgtggatggtataaagtgttaaaccaggag
gagggggagtactacaatgtgcccattccagatgaagatgatgagaatactgagctccga
cagaagtttgagaaagccaaattgggtccatccaaaagagccaccactcctttggatgat
agtgggtccactttaccctcaagcagtatggacagagtcaaactcacagactttaatttc
ttggcagtgttgggaaaaggcagttttggaaaggtgatgctggctgagatgaagtctact
ggtgaactatttgctataaagatccttaagaaggatgtggtcatccaggatgatgatgtt
gaatgcaccatggtggagaagcgggttctggctcagcaggacaaacctccattcctcacc
cagcttcactcctgctttcagactgtggatcgtctgtatttcgtgatggagtatgttaat
ggtggtgatctgatgtaccacatccagcaagtgggcaaatttaaggagccacaagcggtg
ttctacgctgcagagattgctgttggactttttttcttgcacaagaaaggagtcatatac
agggatctgaaattagataatgtcatgctggatgcagagggtcatattaagattgcagac
ttcggtatgtgcaaggagaacattgtggagggtgtgaccacccgtacattttgtggaacg
ccagactacatcgctccagagataatagcatatcagccgtatggccgttctgtggactgg
tgggcttatggagtgctgctgtacgagatgctggcgggacagcctccatttgatggtgag
gatgaagacgaactttttcagtccattatggagcacaacgtctcctaccctaaatccatg
tccaaagaagcagtttccatctgcaaagggctgatgacaaaacactcttcaaagcgtctg
ggctgcagcccagagggggaaagagatattagggaacatgctttcttccgtcggattgac
tgggaacgcctggaaaacagagaaatacagcctccattcaaacccaaagtgtgtggaaag
ggggcagagaactttgacaagttcttcacacgcacacagccacaactgacccctcctgat
gagctggttatcgccaacatcgaccaggctgaatttgatggattttccttcatcaacctt
caattcatccatccctccatcatcaacagtgaataa

KEGG   Sinocyclocheilus rhinocerous: 107710697
Entry
107710697         CDS       T04916                                 

Definition
(RefSeq) protein kinase C alpha type-like
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107710697
   04012 ErbB signaling pathway
    107710697
   04310 Wnt signaling pathway
    107710697
   04370 VEGF signaling pathway
    107710697
   04020 Calcium signaling pathway
    107710697
   04070 Phosphatidylinositol signaling system
    107710697
   04150 mTOR signaling pathway
    107710697
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107710697
   04540 Gap junction
    107710697
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107710697
   04916 Melanogenesis
    107710697
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107710697
   04270 Vascular smooth muscle contraction
    107710697
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107710697
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107710697
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107710697
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107710697
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107710697
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C C1_2
Other DBs
NCBI-GeneID: 107710697
NCBI-ProteinID: XP_016371017
LinkDB
Position
Unknown
AA seq 654 aa
MADHLIQINDSSVAVNRFARKGAQRKKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVSFSCPGADKGPDTDVTCDMNVHKQCVMNVPSLCGTDHTER
RGRLFLKIEVSGDRLHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPKNETKQKTRTIRSS
LNPTWNESFIFKLKPSDKERRLSVEVWDWDRTTRNDFMGSMSFGVSELIKAPLCGWYKML
NQEEGEYYNVPIPEESDINLELRQKFEKARLGPGKKVITPSDHRRFSLPSGNMNRVQLND
FHFLALLGKGSFGKVMLAERKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLAQRDKPP
FLTQLHSCFQTVDRLYFVMEYINGGDLMYHIQQVGKFKEPQAVFYAAEIAAEVALTSLIL
STRTRPYAPTAKDHTINCELSAGDLKLDNVMLDSEGHIKIADFGMCKEHMYEGMTTRTFC
GTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPK
SLSKEAVSICKGLMTKHPSKRLGCGPEAERDIKEQAFFRRIDWERLANREIQPPFKPKVC
GKAAENFDKFFTRTQPMLTPPDQLVIANIDQSEFAGFSYINPEFIHPSSLHSVV
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggctgatcatctgatacagatcaatgactcgtccgtcgcggtcaatcgattcgcgcgg
aaaggagctcagcgaaagaagaacgtgcacgaagttaaaaaccacaaatttatcgctcga
ttcttcaagcagcccacattctgcagccactgcaccgactttatctggggatttggaaag
caaggcttccagtgccaagtgtgctgttttgtggtccacaaaaggtgccatgagtttgtt
tcattctcctgtccaggggccgacaagggccctgacacagatgtgacctgtgacatgaac
gttcataagcagtgtgtgatgaacgtgccaagtctgtgcgggaccgaccacactgaacgc
agaggaagactcttcctcaagatcgaggtcagcggagacagacttcacgtcacagtgggt
gaggcccgaaatctgattcccatggaccccaatggtctatcagacccgtatgtgaagctc
aaactcatcccagaccccaagaatgagaccaaacagaagacccgcaccatccgctcctcg
ctcaaccccacctggaacgagtccttcatctttaagttaaagccatcggataaggagcgc
cgtctgtccgtggaggtgtgggattgggacagaaccacccgtaatgacttcatgggctcc
atgtcctttggtgtgtctgagctgatcaaagctcctctatgtggctggtataagatgtta
aaccaggaggagggtgagtactacaacgtgcccatcccagaggagagtgacattaacctg
gagctgcggcagaagtttgagaaagccaggctcggtcctgggaagaaagtcatcactccc
tctgatcaccgacgcttcagtttaccatccggaaacatgaacagagttcaactcaatgac
ttccattttctggctcttctgggcaaaggcagttttgggaaggtaatgttggcagagagg
aagtccactgaggagctgtacgccattaaaatcctgaagaaggacgtggtgatccaggat
gatgatgtggagtgcacaatggtggagaagagagtgctggcccagagagataagccacct
ttcctcacccagctgcactcctgcttccagactgtggatcgtctgtactttgtaatggag
tacattaacggtggagacctgatgtatcacatccagcaagtgggcaagtttaaggagcca
caagccgtattctatgcagcagagattgctgctgaggtcgccctgacctcgcttatactg
tccactcgcacgcggccatacgcacccacagctaaagaccacactattaactgtgaactg
tctgccggagatctgaagttggataacgtgatgttggactccgagggccacatcaagatt
gcagacttcggcatgtgtaaggaacacatgtatgagggcatgacgacacgcaccttctgt
ggaacgccggattacatcgccccggagataatcgcctatcagccgtacgggaaatcagtg
gactggtgggcgtacggtgtgctcctctacgagatgctggctgggcagcctccatttgat
ggcgaggatgaggatgagctctttcagtccataatggagcacaatgtgtcttaccccaaa
tccctgtctaaagaggcagtgtccatctgtaaagggctgatgacgaagcatccatccaag
cgtctaggttgcggtccagaggctgagcgagatataaaggagcaagctttcttccgcaga
atcgactgggaacggttggccaacagagagatccagcctcctttcaaacccaaagtgtgc
ggcaaagcggcggagaacttcgacaaattcttcacccgcacgcagcccatgctgacccct
ccagaccaactggtcatcgccaacatcgaccagagcgaattcgctggattctcttacata
aacccagagttcatccacccatcgtcgcttcacagtgtggtatga

KEGG   Sinocyclocheilus rhinocerous: 107716883
Entry
107716883         CDS       T04916                                 

Definition
(RefSeq) protein kinase C alpha type-like
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04261  Adrenergic signaling in cardiomyocytes
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107716883
   04012 ErbB signaling pathway
    107716883
   04310 Wnt signaling pathway
    107716883
   04370 VEGF signaling pathway
    107716883
   04020 Calcium signaling pathway
    107716883
   04070 Phosphatidylinositol signaling system
    107716883
   04150 mTOR signaling pathway
    107716883
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107716883
   04540 Gap junction
    107716883
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107716883
   04916 Melanogenesis
    107716883
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107716883
   04270 Vascular smooth muscle contraction
    107716883
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107716883
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:srx04131]
    107716883
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107716883
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107716883
Membrane trafficking [BR:srx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107716883
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1
Other DBs
NCBI-GeneID: 107716883
NCBI-ProteinID: XP_016378975
LinkDB
Position
Unknown
AA seq 763 aa
MAAGDELVSALVVEQLEEQAERREGAEEMAASIRSEAFLRRASSSPEMCCFVVHKRCHEF
VTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDSCDMNVHK
QCVMNVPSLCGTDHTERRGRLYLKIEVIEDKMHVTVGEGKNLIPMDPNGLSDPYVKLKLI
PDPKHETKQKTKTIRSSLNPAWNESFTFKLKPADKDRRLSVEVWDWDRTTRNDFMGSMSF
GVSELKKSSVCGWYKVLNQEEGEYYNVPIPDEDDEDTELRQKFEKAKLGPPKKTITTFDA
SGSTLPSSSVDSVKLTDFNFLAVLGKGSFGKVMLAEMKSSDELYAIKILKKDVVIQDDDV
ECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAV
FYAAEIAVGLFFLHKKGVIYRDLKLDNVMLDAEGHIKVADFGMCKENIVEGVTTRTFCGT
PDYIAPEIIAYQPYGGSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQCIMEHNVSYPKSM
SKEAVSICKGLMTKHPSKRLGCSLEEERDIREHAFFRRIDWERLENREIQPPFKPKVVRK
SMQVYSCKFAEEFTSVQAQQMCTSRVHMEGHAVFQDELVRILTRAVSYLGLEWESPDEPA
KSKLDSWFLHTGRRAASPRTRAPFFPDLHDEVDKAWAAPQSARTDARRGIHRSAPLSLVC
LSEGGCFAAVEALPSDRSHHRQGIHRSQRFTQWRCSKFFRHSS
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcagcaggggacgagctggtgtctgcgctggtcgttgagcagctcgaagagcaggcg
gagcggcgagagggtgcagaagagatggcagcttctatccgcagcgaggcttttctacgg
cgagcgtcttcaagtcctgaaatgtgctgttttgtggtccataaacgttgccatgaattt
gtcacattctcatgccctggagctgataaagggccagacacagatgaccctagaagcaag
cacaagtttaagatccacacctatggcagtcccacattctgtgaccactgtggatctctt
ctgtatggactcatacaccaagggatgaaatgtgactcctgtgatatgaatgtccataag
cagtgtgtgatgaatgtgccaagcctttgtggaacggaccacacagagagacgaggacgt
ctttacttgaagatcgaggtgatagaagacaaaatgcatgtcacagttggggaaggcaag
aacttgattccaatggacccgaatggattgtctgatccatatgtaaaactcaagttgatt
ccagaccctaaacatgagacgaaacagaaaacgaaaaccatccgttcttccctgaatcca
gcttggaacgagtcatttacatttaaactgaagccagcagataaggaccgtcggctgtct
gtggaggtgtgggactgggacagaaccacccgtaatgatttcatgggctcaatgtctttt
ggtgtgtctgagctcaagaaatcctcagtgtgtggatggtataaagtgttaaaccaggag
gagggggagtactacaatgtgcctattccagatgaagatgacgaggataccgagctccga
cagaagtttgagaaagccaaattgggtccacccaaaaaaaccatcaccacttttgatgcc
agtggatccactttaccctcaagcagtgtggacagtgtcaagctcacagactttaatttc
ttggcagtattgggaaaaggcagttttggaaaggtgatgctggctgagatgaagtcttct
gatgaactatatgctataaagatcctgaagaaggatgtggtcatccaggatgatgatgtt
gaatgcaccatggtggagaagcgggttctggctcagcaggacaaacctccattcctcacc
cagctccactcctgctttcagactgtggatcgtctgtatttcgtgatggagtatgttaat
ggtggtgatctgatgtaccacatccagcaagtgggcaaatttaaggagccacaagcagtg
ttctacgctgcagagattgctgttgggctttttttcttgcacaagaaaggagtcatatac
agggatctgaaattagataatgtcatgctggatgcagagggtcatattaaggttgcagac
ttcggtatgtgcaaggagaacattgtggagggtgtgaccacccgtacattttgtggaacg
ccagactacattgctccagagataatagcatatcagccgtatggcggttctgtggactgg
tgggcctatggagtcctgctgtacgagatgctggcaggacagcctccatttgatggtgag
gatgaagatgaacttttccagtgcattatggagcacaacgtctcctaccctaaatccatg
tccaaagaagcagtttccatctgcaaagggctgatgacaaaacacccttcaaaacgtctg
ggctgcagcctagaggaggagagagatattcgggaacatgctttcttccgtcggattgac
tgggaacgtctggaaaatagagaaatacagcctccattcaaacccaaagtggtaagaaaa
tccatgcaggtctattcgtgtaagtttgctgaggagttcacttcagtgcaggctcagcag
atgtgcacatcgagggtgcatatggagggacacgccgtgtttcaggacgagcttgtccgg
attctcaccagggccgtgagctatctaggtctggagtgggaatcccccgatgaaccagct
aaaagcaaactggattcatggttccttcacacgggccgccgagctgcctctccaaggacg
cgagccccgtttttccccgacctgcacgacgaggtcgataaggcgtgggctgcaccccag
tcggctcgcaccgacgcccgtcgaggaatccatcgcagtgcacctctgtccctcgtctgc
ctctctgaaggcgggtgctttgctgccgtcgaggccctgccatctgaccgctcacatcac
agacaaggcatacaccgatctcagcgcttcacacaatggcggtgctccaagtttttcagg
cacagctcctga

KEGG   Sinocyclocheilus rhinocerous: 107722959
Entry
107722959         CDS       T04916                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107722959
   04012 ErbB signaling pathway
    107722959
   04310 Wnt signaling pathway
    107722959
   04370 VEGF signaling pathway
    107722959
   04020 Calcium signaling pathway
    107722959
   04070 Phosphatidylinositol signaling system
    107722959
   04150 mTOR signaling pathway
    107722959
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107722959
   04540 Gap junction
    107722959
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107722959
   04916 Melanogenesis
    107722959
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107722959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107722959
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107722959
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107722959
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 zf-RING_9 Kinase-like CBX7_C APH
Other DBs
NCBI-GeneID: 107722959
NCBI-ProteinID: XP_016386943
LinkDB
Position
Unknown
AA seq 668 aa
MADPVAAEGAGGARGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQG
FQCQVCGFVVHKRCHEFVAFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYG
LIHQGMKCDTCMMNIHKRCVENVPSLCGTDHTERRGRLHISASITNNVLTVTVKEARNLV
PMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWDEHFSFNLRDTDKDRRLSVEV
WDWDLTSRNDFMGSMSFGISELQKQGVNGWFKLLGQEEGEYFNVPVPPDGEEGNEELRQK
FERAKIGPGNKNTDGSSKNDISKYDANGNKDRMKLSDFNFIMVLGKGSFGKVMLAERKGS
DELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFVMEYIN
GGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGIIYRDLKLDNVMLDAEGHIKIAD
FGMCKENMFDGATTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYMD
WEKLQSKEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIQNLDQEEFQGFSFNNS
NFVSVKSK
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccgacccagtggctgcggagggcgcggggggcgcacgaggcttcgccaggcagggc
gcgctgaggcagaagaacgtacacgaagtgaagaaccacaagttcatcgcgcgcttcttc
aagcagccgaccttctgcagccactgcaccgacttcatctggggtttcggcaagcaaggc
ttccagtgtcaagtatgcggttttgtggtccacaaacgctgccatgagtttgttgctttc
tcctgccctggagccgacaagggcccagcatcagatgaccctcgcagtaagcataagttc
aaggtacacacatactccagccctaccttctgtgaccactgtggatctctactgtacggg
ctcatacaccaggggatgaaatgcgacacttgtatgatgaatattcataaacgatgcgtg
gaaaatgttcccagcttgtgtggaacagaccacaccgagaggagaggacggctgcatatc
agtgctagtataacaaataatgttctcaccgtgaccgtcaaggaggctcgtaacttggtg
ccaatggatccaaacggcctgtcagatccatatgtgaagcttaaattaattccagaccca
aagagcgagagcaagcagaagacaaaaaccatcaagtgctccctcaatcctacatgggac
gaacacttcagctttaacctcagagatacagataaagacaggcgtttgtcagtggaggtg
tgggattgggatctgaccagcagaaatgacttcatggggtcgatgtcttttggcatctct
gagctgcagaaacaaggtgtcaacggatggtttaagttgctgggccaagaggaaggagag
tatttcaacgttccagttccaccagatggagaggagggcaatgaagaactgcggcagaaa
tttgagagagccaagattggccctggcaataagaatacagatggctcttcaaagaatgac
atctctaaatatgatgccaatggcaacaaagaccgcatgaagctctcagacttcaacttc
atcatggtgctgggcaaaggcagctttggcaaggtgatgcttgccgaacgtaaaggctca
gatgagctgtacgcagtgaagatcttgaagaaggatgtggtcattcaggatgatgatgtg
gaatgcactatggtggagaagagagttctcgctctctctggcaaaccgcccttcctcacc
catctccactcgtgctttcagaccatggatcgtctttactttgtgatggagtatatcaac
ggtggagatttgatgtatcaaatacaacaagttggaaaatttaaggaaccccatgctgtg
ttctacgctgcagaaattgccattggcttgttctttcttcattcaaagggcattatttac
agagatctgaaactggataatgtgatgttggatgctgaaggccacattaagattgcagat
tttggcatgtgcaaagaaaacatgtttgatggggccacaaccaaaaccttctgtggcact
ccagactacattgccccagagatcattgcatatcaaccatatggcaagtctgtcgactgg
tgggcgtatggagttttactgtatgaaatgctggcaggacagcccccttttgatggtgag
gatgaagatgagcttttccagtccatcatggagcatcatgtgtcttacccgaaatccatg
tccaaagaagcagtggccatatgcaaggggctgatgaccaagcatccagggaagcgcctg
ggctgtggaccagaaggagaacgagacattaaggaacacgctttcttccgctacatggac
tgggaaaaactgcaaagcaaggaagttcaaccccccttcaaacccaaagcatgcggtcga
gacgcagagaactttgatcgttttttcacccgccatcctcccgtcctgacccctcctgac
caggaagtgattcaaaacctggaccaagaagaatttcagggcttctcgttcaataattca
aattttgtatctgtgaaatccaagtag

KEGG   Sinocyclocheilus rhinocerous: 107725358
Entry
107725358         CDS       T04916                                 

Gene name
prkcb
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107725358 (prkcb)
   04012 ErbB signaling pathway
    107725358 (prkcb)
   04310 Wnt signaling pathway
    107725358 (prkcb)
   04370 VEGF signaling pathway
    107725358 (prkcb)
   04020 Calcium signaling pathway
    107725358 (prkcb)
   04070 Phosphatidylinositol signaling system
    107725358 (prkcb)
   04150 mTOR signaling pathway
    107725358 (prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107725358 (prkcb)
   04540 Gap junction
    107725358 (prkcb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107725358 (prkcb)
   04916 Melanogenesis
    107725358 (prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107725358 (prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107725358 (prkcb)
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107725358 (prkcb)
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107725358 (prkcb)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C C1_2 Kinase-like zf-RING_9 CBX7_C APH RIO1 CEP76-C2 PHD
Other DBs
NCBI-GeneID: 107725358
NCBI-ProteinID: XP_016390081
LinkDB
Position
Unknown
AA seq 604 aa
MADPAAAGGARGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQGFQC
QVCGFVVHKRCHEFVTFSCPGADKGPASDDPRSKHRFKVHTYSSPTFCDHCGSLLYGLIH
QGMKCDTCMMNIHKRCVENVPSLCGTDHTERRGRLHISASITNNVLTVTVKEARNLVPMD
PNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWDEHFSFNLRDTDKDRRLSVEVWDW
DLTSRNDFMGSMSFGISELQKQGVDGWFKLLGQEEGEYFNVPVPPDLVMLAERKGADELY
AVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDL
MYQIQQVGKFKEPHAVFYAAEIAIGLFFLQSKGIVYRDLKLDNVMLDAEGHIKIADFGMC
KENMFDGTTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDE
LFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYMDWEKL
QNMEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIQNLDQEEFQGFSYINQNFAS
VKSK
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggccgacccagcggctgcggggggcgcgcgaggcttcgccaggcagggcgcgctgagg
cagaagaacgtgcacgaagtgaagaaccacaagttcatcgcgcgcttcttcaaacaaccg
accttctgcagccactgcaccgacttcatctggggtttcggcaagcaaggcttccagtgt
caagtgtgcggtttcgtggtccacaaacgctgccatgagtttgttactttctcctgcccc
ggggccgacaagggccccgcatcagatgaccctcgaagtaagcataggttcaaggtacac
acatactccagccccacattctgtgaccactgtggttctctactgtacgggctcatacac
caggggatgaaatgcgacacttgtatgatgaatattcataaacgatgcgtggagaatgtt
cccagcctgtgtggaacagaccacaccgagaggagaggacggctgcatatcagtgctagt
atcacaaataatgttctcacagtgactgtcaaggaagctcgtaacttggtgccaatggat
ccaaacggcctgtcagatccatacgtgaagcttaaattaattccagacccaaagagcgag
agcaagcagaagaccaaaaccatcaagtgctccctcaatcctacctgggacgaacacttc
agctttaacctcagagatacagataaagacaggcgtttgtcagtggaggtgtgggattgg
gatctgaccagcagaaatgacttcatggggtcgatgtcttttggcatctctgagctgcag
aaacaaggtgtcgacggatggtttaagttgctgggccaagaggaaggggagtatttcaac
gttccagttccaccagacttagtgatgctcgccgagcgtaaaggcgcagatgagctgtac
gcggtgaagatcttgaagaaggatgtggtcattcaggatgatgatgtggaatgcactatg
gtggagaagagagttctcgctctctctggcaaaccacccttcctcacccagctccactcg
tgctttcagaccatggaccgtctttactttgtgatggagtatatcaacggtggagatttg
atgtatcaaatacaacaagtgggaaaatttaaggaaccccatgctgtgttctatgctgca
gaaattgccatcggcttgttctttcttcaatcaaagggcattgtttacagagatctgaag
ctggataatgtgatgttggatgctgaaggccacattaaaattgcagattttggcatgtgc
aaagagaacatgtttgatgggaccacaaccaaaaccttctgtggcactccagactacatt
gccccagagatcattgcatatcagccgtatggcaagtctgttgactggtgggcttatgga
gttctcctctatgaaatgctggcaggacagcccccttttgatggtgaggatgaagatgag
cttttccagtcaatcatggagcatcatgtgtcttaccccaaatccatgtccaaagaagca
gtggccatatgcaaagggctgatgaccaagcatccagggaagcgtctgggctgtggaccg
gagggagagcgagacattaaggaacacgctttcttccgctacatggactgggaaaaactg
caaaatatggaagttcaacctcccttcaaacccaaagcatgcggtcgagacgcagagaac
tttgatcgttttttcacccgccatcctcccgtcctgacccctcctgaccaggaagtgatt
caaaacctggaccaagaagaatttcagggcttctcgtacattaatcaaaattttgcatct
gtgaaatccaagtag

KEGG   Sinocyclocheilus rhinocerous: 107752983
Entry
107752983         CDS       T04916                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04020  Calcium signaling pathway
srx04070  Phosphatidylinositol signaling system
srx04150  mTOR signaling pathway
srx04270  Vascular smooth muscle contraction
srx04310  Wnt signaling pathway
srx04370  VEGF signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04912  GnRH signaling pathway
srx04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107752983
   04012 ErbB signaling pathway
    107752983
   04310 Wnt signaling pathway
    107752983
   04370 VEGF signaling pathway
    107752983
   04020 Calcium signaling pathway
    107752983
   04070 Phosphatidylinositol signaling system
    107752983
   04150 mTOR signaling pathway
    107752983
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107752983
   04540 Gap junction
    107752983
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107752983
   04916 Melanogenesis
    107752983
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107752983
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107752983
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107752983
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107752983
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C CEP76-C2 C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107752983
NCBI-ProteinID: XP_016424550
LinkDB
Position
Unknown
AA seq 670 aa
MAEQSNSDGEERSAPMRGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAK
NLVPMDPNGLSDPYVKLKLIPDPMSKSKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLS
VEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKMLSQEEGEYFNVPVPPEGEEGNEEL
RQKFERAKIGPNKTDGSSSNTISKFDSNGNQDRMKLSDFNFLMVLGKGSFGKVMLAERKG
GDELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYI
SGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHVKGIVYRDLKLDNVMLDMEGHIKIA
DFGMCKENMLDGITTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDG
EDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYM
DWEKLENKEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFIN
PEYPAMEAQS
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcagagcaatcgaacagcgatggagaggagaggagcgcacccatgaggggctttgcc
cgacaaggtgccctgagacagaaaaacgttcacgaagttaagaaccacaagtttatcgct
cgcttcttcaagcagcctactttctgcagccactgcacggactttatctggggttttggg
aaacaaggatttcagtgtcaagtctgctgctttgtggtgcacaagcgttgccatgaattc
gtcaccttctcctgcccaggagcagataagggtcctgcatcagatgacccgcgcagtaag
cacaagttcaaggtccacacgtactccagccccaccttctgtgaccactgcggctctctg
ctgtatggactcatccaccagggcatgagatgtgaccactgcatgatgaacatccataag
cgctgtgtggccaacgtgccgagtctgtgtgggactgaccatactgagaggaggggccgc
atccaaatcaccgcagagatcaagaacaatgtgctcaccgtcagcattaaagaggcgaag
aacctggtgcccatggaccccaatggcctctctgacccctacgtcaaactaaaactcatc
cctgaccccatgagcaagagcaaacaaaagaccaagaccatcaagtgctgcctgaatccc
acgtggaacgagaccttcacatttaatctgaaggagtctgacaaggaccgcaggctgtct
gtggagatctgggactgggacttgaccagccggaacgactttatgggctctctgtctttc
ggcatctcggagcttcagaagcaaggggtggacggatggtttaagatgctcagtcaggaa
gagggcgagtacttcaacgttcctgtcccacccgaaggtgaagaaggcaatgaggaactc
cggcagaagtttgagagagctaaaattggtcccaacaaaacagacggctcttcctccaac
accatctccaaatttgacagcaatggcaaccaggaccgcatgaaactgtccgacttcaat
tttctcatggtgttgggcaagggtagctttggaaaggtgatgttggccgagagaaaggga
ggtgatgagctgtttgcaataaagatcctgaagaaggacgtggtgatccaggatgatgac
gtagaatgcactatggtggagaagagagtgttggccttgtcaggaaaaccacccttcctc
actcaactgcactcctgctttcagaccatggaccgcctgtactttgtcatggaatacatc
agtggtggggatctcatgtatcatatccagcaggtcggcaagtttaaggaaccccatgct
gtgttctatgctgcagaaatcgccataggcctgttctttctgcatgtgaagggtattgta
tacagagatctaaagttggataatgtcatgttggacatggagggtcatatcaaaatagct
gactttggcatgtgcaaggagaacatgcttgatggaatcaccaccaagaccttctgtggg
acccctgactacatcgcccctgagatcatcgcttaccagccttatggaaagtcagtggac
tggtgggcttttggagttctgctctatgagatgctggctgggcagcccccatttgatggt
gaggatgaggatgagctgtttcagtccatcatggagcaccatgtgtcctatcctaaatcc
atgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccaggcaagcgt
ctgggctgcggtcctgagggtgagcgggacatcagggaacacggctttttccgttacatg
gattgggagaagctggagaacaaggaagttcagccaccatttaaaccaaaagcctgtggc
cgggatgcagagaactttgaccgctttttcacacgccatccaccggttctcacccctcca
gaccaggaggtcatcatgaacctcgaccaagacgagtttgagggcttttccttcataaac
cccgaataccctgccatggaagcccagagttaa

DBGET integrated database retrieval system