KEGG   Sinocyclocheilus rhinocerous: 107711004
Entry
107711004         CDS       T04916                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107711004
   04012 ErbB signaling pathway
    107711004
   04370 VEGF signaling pathway
    107711004
   04371 Apelin signaling pathway
    107711004
   04068 FoxO signaling pathway
    107711004
   04150 mTOR signaling pathway
    107711004
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107711004
  09143 Cell growth and death
   04210 Apoptosis
    107711004
   04218 Cellular senescence
    107711004
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107711004
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107711004
   04625 C-type lectin receptor signaling pathway
    107711004
  09152 Endocrine system
   04910 Insulin signaling pathway
    107711004
   04920 Adipocytokine signaling pathway
    107711004
   04914 Progesterone-mediated oocyte maturation
    107711004
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107711004
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107711004
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107711004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107711004
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107711004
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107711004
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 107711004
NCBI-ProteinID: XP_016371394
UniProt: A0A673M2I6
LinkDB
Position
Unknown
AA seq 479 aa
MNEVSIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPETSDHNQPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNAEREEWIRAIQAVANGLKSREEEEPMD
INFGSPGDNSLEGMEAAIAKSRTKVTMSDFDYLKLLGKGTFGKVILVREKATGMYYAMKI
LRKEVIIAKDEVAHTITESRVLQNTRHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLS
RERVFTEDRARFYGAEIVSALEYLHSKDVVYRDLKLENLMLDKDGHIKITDFGLCKEGIT
NEATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGGGPDDAKEVMTHKFFSSMNWQDVLQKKL
MPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDSLDAEDPDTRTHFSQFSYSASVRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaggtcagcatcgtcagagagggctggctccacaagagaggtgaatacattaag
acttggaggccccgatatttcattctaaagagtgatggctctttcatcggctacaaggag
aagccagagacgtcagaccacaatcagccgcctctcaataacttttctgttgcagagtgt
cagctgatgaagactgaacgacctcggccaaacacgtttgtcattcgctgcttgcagtgg
accactgttattgagcgcaccttccatgtggacagcaatgctgaaagagaggagtggata
cgtgcaatccaggctgtggccaatgggctcaagtcccgggaagaggaggagccaatggac
atcaactttggctcccctggagacaacagcttggaggggatggaggctgccatcgcaaag
tcccgcaccaaagtgacaatgagtgactttgactacttaaagctgctgggtaaaggcact
tttggaaaggtgattctagtaagggaaaaggctactggcatgtactatgccatgaagatc
ctacgcaaagaggtcatcattgctaaggacgaggttgcacacacaatcacggaaagcaga
gtgttgcagaacacacggcatccgttccttacaacactaaaatacgccttccagacacga
gatcgattgtgtttcgtcatggagtacgcaaatggaggcgagctgttcttccacttgtct
cgagagcgtgtgtttacggaggatagagctcgcttctatggggctgaaattgtttcagca
ttggaatatctgcactctaaagatgtcgtctacagggacctaaagctggagaatctgatg
ctggacaaagatggtcatattaaaatcacagactttggcctgtgtaaagagggcattact
aatgaggccaccatgaagacattctgtgggaccccagagtaccttgctcctgaggtatta
gaagacaatgattacggccgtgcagtggattggtggggtctgggagtggtcatgtatgaa
atgatgtgtggtcggctgcctttctataaccaggaccacgaacgtctgtttgagctcatt
ttaatggaggagattcgcttccctagaaacctctcgcccgaggcaaaggccttgctggcc
ggcctgctcaagaaagaccccaaacagaggcttggaggaggtcctgatgatgccaaagaa
gtgatgacacacaagttcttcagttccatgaactggcaagatgtccttcaaaagaagctc
atgccacccttcaagccgcaagtgacctcagagacagacacacgctactttgacgacgag
ttcactgcacagaccattactgtcacgccacctgaccaatatgacagtcttgatgccgag
gacccagatacacgcacacacttctcgcagttctcctactcagccagtgtgcgggagtga

KEGG   Sinocyclocheilus rhinocerous: 107714435
Entry
107714435         CDS       T04916                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107714435
   04012 ErbB signaling pathway
    107714435
   04370 VEGF signaling pathway
    107714435
   04371 Apelin signaling pathway
    107714435
   04068 FoxO signaling pathway
    107714435
   04150 mTOR signaling pathway
    107714435
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107714435
  09143 Cell growth and death
   04210 Apoptosis
    107714435
   04218 Cellular senescence
    107714435
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107714435
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107714435
   04625 C-type lectin receptor signaling pathway
    107714435
  09152 Endocrine system
   04910 Insulin signaling pathway
    107714435
   04920 Adipocytokine signaling pathway
    107714435
   04914 Progesterone-mediated oocyte maturation
    107714435
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107714435
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107714435
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107714435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107714435
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107714435
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107714435
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 107714435
NCBI-ProteinID: XP_016375754
UniProt: A0A673JKB8
LinkDB
Position
Unknown
AA seq 539 aa
MNEVSIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPETSDHNQPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNAEREEWIRAIQAVANGLKSREEEEPMD
INFGSPGDNSLEGMEAAIAKSRTKVTMSDFDYLKLLGKGTFGKVILVREKATGMYYAMKI
LRKEVIIAKDEVAHTITESRVLQNTRHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLS
RERVFTEDRARFYGAEIVSALEYLHSKDVVYRDLKLENLMLDIDGHIKITDFGLCKEGIT
NEATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGGGPEDAKEVMTHKFFSSMNWQDVLQKKL
IPPFKPQVTSEIDTRYFDDEFTAQTITVTPPDQYDSLDAEDPDTRTHFSQFSYSASVRSV
LVSNWPFIRPVRSLTLHTATQSINESLNKSQPIRYRRKYSSAPAGFRTHAHTQNTGLRD
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaacgaggtcagcatcgtcagagagggctggctccacaagagaggtgaatacattaag
acttggaggccccgatatttcatcctaaagagtgatggctctttcattggctacaaggag
aagccagagacgtcagaccacaatcagccccctctcaataacttctctgttgcagagtgt
cagctgatgaagactgaacgacctcggccgaacacgtttgtcatccgctgcttgcagtgg
accactgttattgagcggaccttccacgtggatagcaatgctgaaagagaggagtggata
cgtgcaatccaggctgtggccaatgggctcaagtcccgggaagaggaggagccaatggac
atcaactttggctcccctggagacaacagcctggagggaatggaggctgccattgcaaag
tcccgcaccaaagtgacaatgagtgactttgactacttaaagctgctgggtaaaggcact
tttggaaaggtgattctagtgagggaaaaggctactggcatgtactacgccatgaagatc
ctacgcaaagaggtcatcattgctaaggacgaggttgcacacacaatcacagaaagcaga
gtgttacagaacacacggcaccccttccttacgacactaaaatacgccttccagacacga
gatcgattgtgttttgtcatggagtacgcaaatggaggcgagctgttcttccacttgtct
cgagagcgtgtgtttacggaggatagagctcgcttctatggggctgaaattgtttcagca
ttggaatatctgcactctaaagatgtcgtctacagggacctaaagctggagaatctaatg
ctggatatagatggtcacattaaaatcacagactttggcttgtgtaaagagggcattact
aatgaggccaccatgaagacattctgtgggaccccagagtaccttgctcctgaggtatta
gaagacaacgattacggccgtgcagtggattggtggggtctgggagtggtcatgtatgaa
atgatgtgtggccggctgccattctataaccaggaccatgaacgtctgtttgagctcatt
ttaatggaggagattcgcttccccagaaacctctcgcccgaggcaaaggccttgctggcc
ggccttctcaagaaagaccccaaacagaggcttggaggaggtcctgaggatgccaaagaa
gtgatgacacacaagttcttcagttccatgaactggcaagatgtccttcaaaagaagctc
atcccacccttcaagccgcaagtgacctcagagatagacacacgctactttgacgacgag
ttcacggcacagaccattactgtcacgccacctgaccaatatgacagtcttgatgcggag
gacccagatacacgcacacacttctcacagttctcctactcagccagtgtgcggtcagtc
ctggtttccaattggcctttcatccggccagtccgtagcctgacactacacactgcaaca
caatccatcaatgaatcactgaataaatctcaaccaatcaggtaccgtcgaaaatacagc
tcagcaccagcaggtttcaggacacacgctcacactcaaaacactggactacgggactaa

KEGG   Sinocyclocheilus rhinocerous: 107714796
Entry
107714796         CDS       T04916                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107714796
   04012 ErbB signaling pathway
    107714796
   04370 VEGF signaling pathway
    107714796
   04371 Apelin signaling pathway
    107714796
   04068 FoxO signaling pathway
    107714796
   04150 mTOR signaling pathway
    107714796
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107714796
  09143 Cell growth and death
   04210 Apoptosis
    107714796
   04218 Cellular senescence
    107714796
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107714796
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107714796
   04625 C-type lectin receptor signaling pathway
    107714796
  09152 Endocrine system
   04910 Insulin signaling pathway
    107714796
   04920 Adipocytokine signaling pathway
    107714796
   04914 Progesterone-mediated oocyte maturation
    107714796
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107714796
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107714796
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107714796
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107714796
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107714796
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107714796
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 107714796
NCBI-ProteinID: XP_016376254
LinkDB
Position
Unknown
AA seq 502 aa
MSRLETSNSSHLLVLVRVKGTRGFFSLATMSDVVIVKEGWLHKRGEYIKTWRPRYFLLKS
DGTFIGYKERPQDVDQLETPLNNFSVAQCQLMKTERPKANTFIIRCLQWTTVIERTFHVE
TPEEREEWTKAIQAVADSLHKQEEERMDSSPDPMDMEVYLSKPRLKVTMHDFEYLKLLGK
GTFGKVILVKEKATGKYYAMKILKKEVIVAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQ
THDRLCFVMEYANGGELFFHLSRDRVFSEERAQFYGAEIVSALDYLHSEKNVVYRDLKLE
NLMLDKDGHIKITDFGLCKEGITEGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVV
MYEMMCGRLPFYNQDHEKLFELILMDEICFPRTLGPEAKSLLSGLLQKDPKQRLGGGPDD
AKETMQHKFFAGIEWQDVYEKKLVPPFKPQVTSETDTRYFDVEFTGQTITITPPGQDENM
ESFDSDRRPHFPQFSYSASGTA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgtctaggctggagacatccaacagttcccaccttctggtcctggtccgagtcaaaggg
acaagagggtttttctctctggccacaatgagtgatgttgtcattgtgaaagagggatgg
ctacataagagaggagaatacataaaaacatggagaccaagatatttcttactcaagagt
gatggaacatttattgggtacaaagagcggccgcaagatgttgaccagctggaaactcca
cttaacaacttctcagtggcccaatgtcagctgatgaagacagagcgaccgaaggcaaac
acttttattattcggtgcctgcagtggactactgttattgaacgcacttttcatgttgag
actccagaggaaagggaggagtggacgaaggctatccaggctgtggcagacagtctacac
aagcaggaggaagagagaatggactcttcacctgaccccatggacatggaggtgtacctg
tccaaacctcgactcaaagtgacaatgcatgactttgaatacctcaaactcttggggaaa
ggcacttttgggaaggtcatactggtgaaggagaaagccacgggcaaatactatgccatg
aaaattcttaaaaaggaggtgatagtagcaaaagatgaggtagcacacacacttactgaa
aaccgggtcctccagaactccaaacaccctttcttaacaggtctgaagtattctttccag
actcatgaccgattatgttttgttatggagtatgcaaatggtggagagcttttctttcat
ttatcgcgagatcgtgttttttcggaagagagagcacagttttatggggcagagatcgtc
tcagccctggattaccttcattctgagaaaaatgtggtttatagagacctaaagttggag
aatttgatgctggataaagacggccacataaagatcactgactttggcctgtgcaaggag
ggaattacagagggagccacaatgaagacgttctgtggtacaccagagtatctggctcct
gaggttcttgaggacaatgattatggccgggcggtggactggtgggggttgggtgtagtc
atgtacgagatgatgtgcggccggctgcccttctacaaccaggatcatgagaaactcttt
gaattgatcctcatggatgagatctgttttcctcgtacacttggacctgaggcaaaatct
ttgctgtcaggactacttcagaaagacccaaagcagcggttaggtggaggtccagatgat
gcaaaagaaaccatgcagcataagttctttgcaggcattgagtggcaagatgtttatgag
aagaagcttgttccaccctttaagccccaggtaacctcagaaacagacactcgctatttt
gatgtggagtttacaggtcagaccatcaccatcacacccccaggccaagatgaaaacatg
gagtcctttgacagtgatagaagaccccacttccctcagttctcatattccgccagtggc
acagcataa

KEGG   Sinocyclocheilus rhinocerous: 107715681
Entry
107715681         CDS       T04916                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107715681
   04012 ErbB signaling pathway
    107715681
   04370 VEGF signaling pathway
    107715681
   04371 Apelin signaling pathway
    107715681
   04068 FoxO signaling pathway
    107715681
   04150 mTOR signaling pathway
    107715681
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107715681
  09143 Cell growth and death
   04210 Apoptosis
    107715681
   04218 Cellular senescence
    107715681
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107715681
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107715681
   04625 C-type lectin receptor signaling pathway
    107715681
  09152 Endocrine system
   04910 Insulin signaling pathway
    107715681
   04920 Adipocytokine signaling pathway
    107715681
   04914 Progesterone-mediated oocyte maturation
    107715681
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107715681
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107715681
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107715681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107715681
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107715681
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107715681
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 FTA2 Pkinase_fungal
Other DBs
NCBI-GeneID: 107715681
NCBI-ProteinID: XP_016377338
LinkDB
Position
Unknown
AA seq 473 aa
MSDVVIVKEGWLNKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKANTFIIRCLQWTTVIERTFHVETPEERVEWTKAIQAVADSLQKQEEERMDS
SPDPMDMEMYLSKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERAQFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITEGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMDEIR
FPRTLGPEAKSLLSGLLQKDPTQRLGGGPDDAKEIMQHKFFAGIEWQGVYEKKLVPPFKP
QVTSETDTRYFDVEFTGQTITITPPGQDENMESFDSDRRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgagtgatgttgtcattgtgaaggagggatggctaaataagagaggagaatacataaaa
acatggagaccaagatatttcttactcaagagtgatggaacatttattgggtacaaagag
cggccacaagatgttgaccagctggaaactccactcaataacttttcagtggcccaatgt
cagttgatgaagacagagcgaccgaaggcaaacacttttattattcggtgcctgcagtgg
actactgttattgaacgcacttttcatgttgagaccccagaggaaagggtggagtggacg
aaggccatccaggctgtggcagatagtctacagaagcaggaggaagagagaatggactct
tcacccgaccctatggacatggagatgtacctgtccaaacctcgactcaaagtgacaatg
catgactttgaatacctcaaactcttggggaaaggcacttttggaaaggtcatactggtg
aaggagaaagccacaggaaaatactatgccatgaaaattcttaaaaaggaggttatagta
gcaaaagatgaggtagcacacacacttactgaaaaccgagtcctccagaactccaaacac
ccttttttaacaggtctgaagtattctttccagactcatgaccgattatgttttgttatg
gagtatgcaaatggtggagagcttttctttcatttatcgcgagatcgcgttttttcggaa
gagagagcacagttttatggagcagagattgtctcagccctggattaccttcattctgag
agaaacgttgtttatagagacttaaagttggagaacttgatgctggataaagatggccac
ataaagattactgattttggcctgtgcaaggagggaattacagagggagcaacaatgaag
acgttctgcggtacaccagagtatctggctccagaggttcttgaggacaatgattatggc
cgggcggtggactggtgggggttgggtgtagtcatgtacgagatgatgtgcggccggctg
cccttctacaaccaggatcatgagaaactctttgaattgatcctcatggatgagatccgt
tttcctcgtacacttggacctgaggcaaaatctttgctgtcaggactgcttcagaaagac
ccaacgcagcggttaggtggaggtccagatgatgcaaaagaaatcatgcagcataagttc
tttgcaggcattgagtggcaaggtgtttatgagaagaagcttgtaccaccctttaagccc
caggtaacctcagaaacagacactcgctattttgatgtggagtttacagggcagaccatc
accatcacacccccaggccaagatgaaaacatggagtccttcgacagtgatagaagaccc
cacttccctcagttctcatattctgccagtggcacagcataa

KEGG   Sinocyclocheilus rhinocerous: 107716055
Entry
107716055         CDS       T04916                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107716055
   04012 ErbB signaling pathway
    107716055
   04370 VEGF signaling pathway
    107716055
   04371 Apelin signaling pathway
    107716055
   04068 FoxO signaling pathway
    107716055
   04150 mTOR signaling pathway
    107716055
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107716055
  09143 Cell growth and death
   04210 Apoptosis
    107716055
   04218 Cellular senescence
    107716055
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107716055
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107716055
   04625 C-type lectin receptor signaling pathway
    107716055
  09152 Endocrine system
   04910 Insulin signaling pathway
    107716055
   04920 Adipocytokine signaling pathway
    107716055
   04914 Progesterone-mediated oocyte maturation
    107716055
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107716055
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107716055
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107716055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107716055
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107716055
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107716055
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 FTA2 APH
Other DBs
NCBI-GeneID: 107716055
NCBI-ProteinID: XP_016377861
UniProt: A0A673LQB4
LinkDB
Position
Unknown
AA seq 474 aa
MTTDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQ
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVESPEEREEWTKAIQTVSDSLQKQEEEMMD
ASPEHMDMEMFLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLAENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFS
EDRARFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDI
RFPRTLAPDAKSLLSGLLKKDPQQRLGGGPDDAKEIMQHKFFTGIVWQDVYEKKLVPPFK
PQVSSETDTRYFDEEFTGQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgacgacggacgtggtgatcgtgaaggagggatggctccacaagcgaggagagtacata
aagacgtggaggccgcgctatttcttgctgaagagtgacggtacgtttattggatataag
gagcgtccgcaggacgtggatcagctggagacgccgttaaacaacttctccgtggcacag
tgtcagctgatgaagacggagcggcccaaacccaacacattcatcatacgctgcctgcag
tggaccactgtcattgagcgcaccttccatgtggagagtcctgaggagcgagaggaatgg
accaaagccatccagacggtgtccgacagtctgcagaaacaagaggaggagatgatggac
gcgtctccagaacacatggacatggagatgtttctgaccaaacctcggctcaaagtgact
atgcatgacttcgaatacctcaaactgctgggaaaaggcacttttgggaaggtgattctg
gtgaaggagaaagcaacaggaaaatattacgccatgaaaatcctcaagaaagaagtgatt
gtagccaaagatgaagtggctcacacactcgcagagaaccgtgtgctgcagaactccaaa
caccccttcctcacgggtctgaaatactctttccagacccacgaccgcttgtgtttcgtc
atggagtacgcaaacggaggagagctgttcttccacttgtctcgggatcgggttttctcg
gaggatcgcgcgcgtttctatggagccgagatcgtgtctgcgctggattacctgcattca
gagcgaaacgtggtctacagggacctgaagctggaaaacctgatgctggataaagacggt
cacataaagatcactgactttggcttgtgtaaggagggaatcacagacggagccaccatg
aagaccttctgtgggactccagagtatctggctcctgaggtgctggaggataatgactac
ggtcgtgcggtggactggtggggtttgggagtggtgatgtatgagatgatgtgcggtcgt
ctgccgttctataaccaggatcacgagcgtctgtttgagctcatcctgatggaggacatc
cgcttccctcgaacactcgcgcccgatgccaagtccctgctgtcaggcctgctcaagaaa
gacccccaacaacggttaggcggcggcccggatgatgcaaaagaaatcatgcagcacaaa
ttcttcactggaattgtgtggcaagacgtttacgagaagaagctggttcctccgtttaaa
ccgcaggtgagctcagaaacagacaccagatatttcgatgaagagttcacaggacagacc
atcaccatcacgccgccgggacaagatgacagtatggagtcgttcgacagcgagaggagg
ccacacttcccacagttctcctactcagccagcggaacggcctaa

KEGG   Sinocyclocheilus rhinocerous: 107722100
Entry
107722100         CDS       T04916                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107722100
   04012 ErbB signaling pathway
    107722100
   04370 VEGF signaling pathway
    107722100
   04371 Apelin signaling pathway
    107722100
   04068 FoxO signaling pathway
    107722100
   04150 mTOR signaling pathway
    107722100
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107722100
  09143 Cell growth and death
   04210 Apoptosis
    107722100
   04218 Cellular senescence
    107722100
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107722100
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107722100
   04625 C-type lectin receptor signaling pathway
    107722100
  09152 Endocrine system
   04910 Insulin signaling pathway
    107722100
   04920 Adipocytokine signaling pathway
    107722100
   04914 Progesterone-mediated oocyte maturation
    107722100
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107722100
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107722100
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107722100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107722100
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107722100
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107722100
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 N2227 Seadorna_VP7
Other DBs
NCBI-GeneID: 107722100
NCBI-ProteinID: XP_016385806
UniProt: A0A673H1K5
LinkDB
Position
Unknown
AA seq 480 aa
MTEVSLVKEGWLYKRGEYIKTWRPRYFILKSDGSFMGYKEKPELTDQSSAPLNNFSVEEC
QLMKTERPRPNTFMIRCLQWTSVIERTFHVESSEERDEWMRAIQAVANGLQAREADEPME
IKYSSPGDVCGLEDMEVSLSKSSSRVTMNDFDYLKLLGKGTFGKVILVREKASGVYYAMK
ILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTPDRLCFVMEYANGGELFFHL
SRERVFSEDRARFYGAEIVSALDYLHSQNVVYRDLKLENLMLDKDGHMKITDFGLCKEGI
TDEATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
IVMEEIRFPKNLSPEAKALLTGLLRKDPKQRLGGGADDAREVMAHKFFSGIHWEDVLQKK
LVPPFKPQVTSETDTRYFDDEFTAQSITVTPPDKLSRQDVEDAGPVAHFPQFSYSASIRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgacggaggtcagcctggtgaaggaaggctggctctataaacgaggtgagtacatcaag
acctggaggccgcgctacttcatcctgaagagtgacggatccttcatgggctataaggag
aagccggagctaacggatcagagctcggctccgctcaataacttctctgtggaagagtgt
cagctgatgaagaccgagcgtccgcggccaaacaccttcatgatccgctgcctgcagtgg
acgagcgtcatcgagagaaccttccacgtggagagcagcgaggagagggacgagtggatg
cgtgcgatccaggccgtggccaatgggctgcaggcgcgggaagcggacgaaccaatggag
atcaagtacagctctcccggtgacgtctgcggtctggaggacatggaggtgtctctgtcc
aaatccagctccagagtgacgatgaatgacttcgattacctgaagctgctgggtaaaggc
acgtttgggaaggtgattctggtgcgagagaaagcctcgggggtgtactacgccatgaag
atcctgcggaaggaagtcatcatcgctaaggatgaagtggcacatacggtcacagagagt
cgagtgctgcagaacaccagacacccgttcctgacgactcttaaatatgccttccagacc
cctgaccggctgtgttttgtgatggagtatgctaatggaggagagctgttcttccatctg
tcccgtgagcgtgtcttctctgaggacagagcgcgcttctacggcgctgagatcgtctcc
gctctcgactatctgcactcacagaacgtcgtctacagggacctgaagctggagaacctc
atgctggataaagacggacatatgaagatcacagactttggtctctgtaaggagggaatc
acagatgaggccaccatgagaacgttctgtggaaccccagaataccttgcgccggaggtg
ctggaggacaatgattacggccgcgcggtggactggtggggtctgggagtggtgatgtac
gagatgatgtgcggacgcttgcccttctacaatcaggaccacgagcggctcttcgagctc
atcgtgatggaggagatccgtttccccaagaacctctcgcctgaagccaaagcgctgctc
accggcctgctgaggaaagaccccaaacagaggctcggaggcggagctgatgacgccaga
gaagtgatggcgcacaagttcttctccggtattcactgggaagacgtgctgcagaagaag
ctggtgccgccctttaaaccgcaggtgacgtccgagacggacacacgctactttgacgat
gagttcacagcgcagagcatcactgttacaccgccagacaagctgagccgtcaggatgtg
gaggacgctgggccggtcgctcacttccctcagttctcttactccgccagcatacgagag
tga

KEGG   Sinocyclocheilus rhinocerous: 107726567
Entry
107726567         CDS       T04916                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107726567
   04012 ErbB signaling pathway
    107726567
   04370 VEGF signaling pathway
    107726567
   04371 Apelin signaling pathway
    107726567
   04068 FoxO signaling pathway
    107726567
   04150 mTOR signaling pathway
    107726567
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107726567
  09143 Cell growth and death
   04210 Apoptosis
    107726567
   04218 Cellular senescence
    107726567
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107726567
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107726567
   04625 C-type lectin receptor signaling pathway
    107726567
  09152 Endocrine system
   04910 Insulin signaling pathway
    107726567
   04920 Adipocytokine signaling pathway
    107726567
   04914 Progesterone-mediated oocyte maturation
    107726567
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107726567
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107726567
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107726567
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107726567
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107726567
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107726567
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Seadorna_VP7 PH_11 FTA2 APH
Other DBs
NCBI-GeneID: 107726567
NCBI-ProteinID: XP_016391683
LinkDB
Position
Unknown
AA seq 427 aa
MTTDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQ
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVERPEEREEWTKAIQTVSDSLQKQEEEMMD
ASPEHMDMEMFLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLAENRVLQNSKHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFS
EDRARFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATM
KTFCGTPEYLAPEVRKTTSNPSQKPVHNGDGVCFVCFRLGGGPDDAKEIMQHKFFTGIVW
QDVYEKKLVPPFKPQSTSETDTRYFDEEFTGQTITITPPGQDDSMESFDSERRPHFPQFS
YSASGTA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgacgacggacgtggtgatcgtgaaggagggatggctccacaagcgaggagagtacata
aagacgtggaggccgcggtatttcttgctgaagagtgacggtacgtttatcggctataag
gagcgtccgcaggacgtggatcagctggagacgccgttaaacaacttctccgtggcacag
tgtcagctgatgaagacggagcggcccaaacccaacacattcatcatacgctgcctgcag
tggaccactgtcattgagcgcaccttccatgtggagaggcctgaggagcgagaggaatgg
accaaagccatccagaccgtgtccgacagtctgcagaaacaagaggaggagatgatggac
gcgtctccagaacacatggacatggagatgtttctgaccaaacctcggctcaaagtgact
atgcacgacttcgaatacctcaaactgctgggaaaaggcacttttgggaaggtgattctg
gtgaaggaaaaagcaacgggaaaatattacgccatgaaaatcctcaagaaagaagtgatt
gtagccaaagatgaagtggctcacacactcgcagagaaccgtgtgctgcagaactccaaa
caccccttcctcacggctctgaagtactctttccaaacccacgaccgcttgtgtttcgtc
atggagtacgcaaacggaggagagcttttcttccacttgtctcgggatcgggttttctcg
gaggatcgcgcgcgtttctacggagcagagatcgtgtctgcgctcgactacctgcattca
gagagaaacgtggtctacagggacctgaagctggaaaacctgatgctggataaagacggt
cacataaagatcactgactttggcttgtgtaaggagggaatcacagacggagccacgatg
aagaccttctgtgggactccagagtatctggctcctgaggtgagaaaaaccacatcaaac
ccctcacagaaaccagtacataatggagacggtgtgtgttttgtgtgttttaggttaggc
ggcggcccggatgatgccaaagaaatcatgcagcacaaattcttcactggaattgtgtgg
caagacgtttacgagaagaagctggttcctccgttcaaaccgcagtcgacctctgagaca
gacaccagatatttcgatgaggagttcacaggacagaccatcaccatcacaccgccggga
caagatgacagtatggagtcgttcgacagcgagaggaggccacacttcccgcagttctcc
tactcggccagcggaacagcgtaa

KEGG   Sinocyclocheilus rhinocerous: 107729704
Entry
107729704         CDS       T04916                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107729704
   04012 ErbB signaling pathway
    107729704
   04370 VEGF signaling pathway
    107729704
   04371 Apelin signaling pathway
    107729704
   04068 FoxO signaling pathway
    107729704
   04150 mTOR signaling pathway
    107729704
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107729704
  09143 Cell growth and death
   04210 Apoptosis
    107729704
   04218 Cellular senescence
    107729704
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107729704
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107729704
   04625 C-type lectin receptor signaling pathway
    107729704
  09152 Endocrine system
   04910 Insulin signaling pathway
    107729704
   04920 Adipocytokine signaling pathway
    107729704
   04914 Progesterone-mediated oocyte maturation
    107729704
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107729704
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107729704
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107729704
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107729704
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107729704
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107729704
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107729704
NCBI-ProteinID: XP_016395860
LinkDB
Position
Unknown
AA seq 479 aa
MNDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWVEAIQMVADKLAKQEEEGILCS
PISQIENVNEEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILR
KEVIVAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTMLHWQDVYDKKLVP
PFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDSADSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaccagaacgtagtgaaagagggatgggtgcagaagagaggtgaatacattaag
aactggagaccgcggtacttcctgttaaagacggatgggtcgtttattggatataaagag
aagccgcaagatgcagatctggcttatccactcaacaacttctctgtggccaagtgtcag
ctgatgaagacggagagaccgaagcccaacaccttcatcatcaggtgtctgcagtggacc
actgttatcgagcgcacgtttcacgtggacacgcctgacgagagggatgagtgggtcgag
gccattcagatggtggcagacaagctggccaaacaggaagaggaaggaatcctgtgtagc
cccatctctcagatcgaaaacgtcaacgaggaagagatggacacgtcaaccagtcatcac
aaacgaaagacaatgaatgactttgactatctgaagctgctgggaaaaggcacatttggg
aaggtgattctggtgcgagagaaagccagcggcacatattatgcaatgaagatcctgaga
aaggaggttattgttgccaaggatgaagttgctcacacactcaccgagagcagagttctg
aagaacactaggcatccgtttctaacttcactgaagtactcatttcagacgaaggatcgt
ttatgttttgttatggagtatgtgaatggaggagagctgttttttcatttgtcgagagag
cgtgtattttcggaggatagaacccgtttctacggcgctgagatcgtttctgcgttggat
tacttgcactctgcaaagattgtttaccgtgacctgaagctggaaaacctgatgttggat
aaggacggtcacataaagatcactgatttcggcctgtgtaaggagggcatcacagacacg
gccaccatgaaaacgttctgcgggaccccggagtatctggcccctgaggtattggaggac
aatgattacgggagagcggtggactggtggggtctgggagtcgttatgtatgagatgatg
tgtggacgccttcccttttataatcaggaccatgagaagctgtttgaactgattctgatg
gaggagatcaagtttcccagaaccctctctgcagacgccaagtctttactgtctggatta
ctcatcaaagaccccaataagaggctcggaggaggcccggatgatgcaaaggaaatcatg
aggcacagtttcttcactatgctgcactggcaggacgtctatgacaaaaagctggtaccg
ccgttcatgccgcaggtctcgtctgagacggacaccaggtatttcgacgaggagttcacg
gcgcagaccatcaccatcacccctccggagaagtacgacgaggacgggatggactcggcc
gatagcgaacggagaccacatttcccacaattctcgtattcagccagcgggcgggagtga

KEGG   Sinocyclocheilus rhinocerous: 107733672
Entry
107733672         CDS       T04916                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107733672
   04012 ErbB signaling pathway
    107733672
   04370 VEGF signaling pathway
    107733672
   04371 Apelin signaling pathway
    107733672
   04068 FoxO signaling pathway
    107733672
   04150 mTOR signaling pathway
    107733672
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107733672
  09143 Cell growth and death
   04210 Apoptosis
    107733672
   04218 Cellular senescence
    107733672
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107733672
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107733672
   04625 C-type lectin receptor signaling pathway
    107733672
  09152 Endocrine system
   04910 Insulin signaling pathway
    107733672
   04920 Adipocytokine signaling pathway
    107733672
   04914 Progesterone-mediated oocyte maturation
    107733672
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107733672
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107733672
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107733672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107733672
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107733672
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107733672
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 107733672
NCBI-ProteinID: XP_016400888
LinkDB
Position
Unknown
AA seq 466 aa
MGGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQLMKTERPKPNTFI
IRCLQWTTVIERTFHVDTLEERDEWAEAIQMVADKLQRQEEERIQCSPTSQIDNMGEEEM
DTSISHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILRKEVIIAKDEVAHT
LTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGA
EIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYL
APEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSADA
KSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGIDWQDVYDKKLMPPFKPQVSSETDTR
YFDEEFTAQMITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgggaggtgaatatattaagaattggagacctcgctacttcctgctaaaaaccgatggg
tcctttatcggatacaaggagaagccacaggatgcagatctaccctaccctctcaataac
ttctctgttgcaaaatgccagctgatgaaaactgaacgaccaaagccaaacacttttatt
attagatgtctacagtggactacagtcatagagaggaccttccacgtggacacactagaa
gagagggatgagtgggcagaggcgatccagatggtggcagataaactccaaagacaggaa
gaggaacgtatccagtgtagtcccacctcacagatagacaacatgggagaggaggagatg
gacacatctatcagccatcacaaacgcaagacaatgaatgactttgactacttaaaatta
ttgggaaaaggcacttttggaaaagtcattcttgtaagggagaaggccagcgggaaatat
tatgcaatgaaaattttaaggaaagaggttattatagcaaaggatgaagtggcccacacg
cttacagaaagcagagtactaaaaaacacgagacatccttttttaacttctttgaagtac
tcgttccaaacaaaagaccgcctatgcttcgtgatggagtatgtcaatggaggagagctg
tttttccatttgtcgagagaacgggtgttctccgaggaccgcacgcgcttctacggcgcc
gagatcgtttccgccctcgactacctgcactctgccaagattgtgtaccgggatctgaag
ttggagaacttaatgcttgataaagatggacacatcaaaattacagactttggcctctgc
aaggaaggaatcactgatgctgctaccatgaagaccttctgtgggacgccagagtatctg
gcaccagaggtgcttgaggacaatgattacggccgtgcggtggactggtggggtcttggt
gtggtcatgtatgagatgatgtgtggccgactacctttctacaatcaggaccatgagaag
ctctttgagctcatcctaatggaggacatcaagttccccaggaccctctctgctgatgcc
aagtcccttctgtcaggcctgctcatcaaagatcccaataagagacttggtggaggtccg
gatgatgctaaggaaattatgcgacatagtttctttgctggaattgactggcaggatgtc
tatgataaaaagctgatgcctcccttcaagcctcaggtgtcgtcagagacagataccaga
tatttcgatgaagagttcacagctcagatgattacaataacccctcctgaaaaattcgat
gaagatgggatggactgcatggacaacgagcgacggccacacttcccccagttctcctac
tctgccagtgggagagagtga

KEGG   Sinocyclocheilus rhinocerous: 107746086
Entry
107746086         CDS       T04916                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107746086
   04012 ErbB signaling pathway
    107746086
   04370 VEGF signaling pathway
    107746086
   04371 Apelin signaling pathway
    107746086
   04068 FoxO signaling pathway
    107746086
   04150 mTOR signaling pathway
    107746086
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107746086
  09143 Cell growth and death
   04210 Apoptosis
    107746086
   04218 Cellular senescence
    107746086
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107746086
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107746086
   04625 C-type lectin receptor signaling pathway
    107746086
  09152 Endocrine system
   04910 Insulin signaling pathway
    107746086
   04920 Adipocytokine signaling pathway
    107746086
   04914 Progesterone-mediated oocyte maturation
    107746086
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107746086
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107746086
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107746086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107746086
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107746086
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107746086
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107746086
NCBI-ProteinID: XP_016415649
LinkDB
Position
Unknown
AA seq 479 aa
MNDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWVEAIQMVADKLAKQEEEGILCS
PISQIENVNEEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTTVDWQDVYDKKLVP
PFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDSADSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaccagaacgtagtgaaagagggatgggttcagaaaagaggtgaatacattaag
aactggagaccgcggtacttcctgttaaagacggatgggtcgtttattggatataaggag
aagccacaagatgccgatctggcatatccgctcaacaacttctctgtggccaagtgccag
ctgatgaagacggagagaccgaagcccaacaccttcatcatccggtgtctgcagtggacc
actgtgatcgagcgcacgtttcacgtggacacgcctgacgagagggatgagtgggtcgag
gcgattcagatggtggcagacaagctggccaaacaggaagaggaaggaatcctgtgtagc
cccatctctcagatcgaaaacgtcaacgaggaagagatggacacgtcaaccagtcatcac
aaacgaaagacaatgaatgactttgactatctgaagctgctgggtaaaggcacatttggg
aaggtgattctggtgcgagagaaagccagcggcacatattatgcaatgaagatcctgaaa
aaggaggttattattgccaaggatgaagttgctcacacgctcaccgagagcagagttctg
aagaacactaggcatccctttctaacttcactgaagtactcatttcagacgaaggatcgt
ttatgttttgttatggagtacgtgaatggaggagagctgttttttcatttgtcgagagag
cgcgtattttcggaggatagaacccgtttctacggcgctgagatcgtttctgcgttggat
tacttgcactctgcgaagattgtttaccgtgacctgaagctggaaaacctgatgttggat
aaggacggtcacataaagatcactgatttcggcctgtgtaaggagggcatcacagacacg
gccaccatgaaaacgttctgcgggaccccggagtatctggcccctgaggtattggaggac
aatgattacgggagagcggtggactggtggggtctgggagtcgttatgtatgagatgatg
tgtggacgcctgcccttttataatcaggaccatgagaagctgtttgaactgattctgatg
gaggagatcaagtttcccagaaccctctctgcagacgccaagtctttactgtctggatta
ctcatcaaagaccccaataagaggctcggaggaggtccggatgatgctaaggaaatcatg
agacacagtttcttcactacagtggactggcaggacgtctatgacaaaaagctggtaccg
ccgttcatgccgcaggtctcgtctgaaaccgacaccaggtatttcgacgaggagttcacg
gcgcagaccatcaccatcacccctccagagaagtacgacgaggacgggatggactcggct
gatagcgaacggagaccacatttcccacaattctcgtattcggccagtgggcgggagtga

KEGG   Sinocyclocheilus rhinocerous: 107747540
Entry
107747540         CDS       T04916                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04261  Adrenergic signaling in cardiomyocytes
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04620  Toll-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04910  Insulin signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04920  Adipocytokine signaling pathway
srx05132  Salmonella infection
srx05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107747540
   04012 ErbB signaling pathway
    107747540
   04370 VEGF signaling pathway
    107747540
   04371 Apelin signaling pathway
    107747540
   04068 FoxO signaling pathway
    107747540
   04150 mTOR signaling pathway
    107747540
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107747540
  09143 Cell growth and death
   04210 Apoptosis
    107747540
   04218 Cellular senescence
    107747540
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107747540
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107747540
   04625 C-type lectin receptor signaling pathway
    107747540
  09152 Endocrine system
   04910 Insulin signaling pathway
    107747540
   04920 Adipocytokine signaling pathway
    107747540
   04914 Progesterone-mediated oocyte maturation
    107747540
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107747540
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107747540
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107747540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107747540
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107747540
Protein kinases [BR:srx01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107747540
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 107747540
NCBI-ProteinID: XP_016417586
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTLEERDEWAEAIQMVADKLQRQEEERIQCS
PTSQIDNMGEEEMDTSISHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGIDWQDVYDKKLIP
PFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttaaggaaggctgggtccagaagagaggtgaatatattaag
aattggagacctcgttacttcctgctaaaaaccgatgggtcctttatcggatacaaggag
aagccacaggatgcagatcttccctaccctctcaataacttctctgttgcaaaatgccag
ctgatgaaaactgaacgaccaaagccgaacacttttattattagatgtctacaatggact
acagtcatagagaggaccttccatgtggacacgctagaagagagggatgagtgggcagag
gcgatccagatggtggcagataaactccaaagacaggaagaggaacgtatccagtgtagt
cccacctcacagatagacaacatgggagaggaggagatggacacatctatcagccatcac
aaacgcaagacaatgaatgactttgactacttaaaattattgggaaaaggcacttttgga
aaagtcattctcgtacgggagaaggccagcgggaaatattatgcaatgaaaattttaaag
aaagaggttattatagccaaggacgaagtggcccacacgcttacagaaagcagagtacta
aaaaacacgagacatccttttttaacctctttgaagtactcgttccaaacaaaagaccgc
ctatgcttcgtgatggagtatgtcaatggaggagagctgtttttccatttgtcgagagaa
cgggtgttctccgaggaccgcacgcgcttctacggcgccgagatcgtttccgccctcgac
tacctgcactctgccaagattgtgtaccgggatctcaagctggagaacttgatgcttgat
aaagatggtcacatcaaaattacagactttggcctctgcaaggaaggaatcactgatgct
gctaccatgaagaccttctgtgggacgccagagtatctggcaccagaggtgctggaggac
aatgattacggccgtgcggtggactggtggggtctcggtgtggtcatgtatgagatgatg
tgtggccgactgcctttctacaatcaggaccatgagaagctctttgagctcatcctaatg
gaggacatcaagttccccaggacgctctctgctgacgccaagtccctactgtcaggcctg
ctcatcaaagatcccaataagagacttggtggaggtccggatgatgctaaagaaattatg
cgacatagtttctttgctggaattgactggcaggatgtctatgataaaaagctgatacct
cccttcaagcctcaggtgtcgtcagagacagataccagatatttcgatgaagagttcaca
gctcagacaattacaataacccctcctgaaaaattcgatgaagatgggatggattgcatg
gacaacgagcgacggccacacttcccccagttctcctactccgccagcgggagagagtga

DBGET integrated database retrieval system