KEGG   Sinocyclocheilus rhinocerous: 107712107
Entry
107712107         CDS       T04916                                 

Definition
(RefSeq) protransforming growth factor alpha-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107712107
   04012 ErbB signaling pathway
    107712107
SSDB
Motif
Pfam: Mucin SSP160 EGF Laminin_EGF PepSY_TM DUF4834 FSA_C
Other DBs
NCBI-GeneID: 107712107
NCBI-ProteinID: XP_016372725
LinkDB
Position
Unknown
AA seq 222 aa
MMVKERQLCVMLLFRCFLIAVTVMSLAIFDFVGSSFSHLGSLFTYGQVQENSNSTTTIAT
TTTTTTTTTTSSTTTTTTTTRVKKFIAAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPA
CVCHPGFVGMRCEHADLLAVVASNHRQQTVATMLVLCVVGSVLLMLLCTLLNCWWRRGGC
GRGNTISCWSEKPRSILTGGTSCCHSETGILVLHFHFYTTFC
NT seq 669 nt   +upstreamnt  +downstreamnt
atgatggttaaggaacggcagctgtgtgtgatgctgttgttccgctgttttctcattgct
gtaacggtcatgagtctggcaatttttgactttgttggatcctcattttcacatttgggc
tccctttttacatatgggcaggtgcaagagaattctaactcaacaacgaccattgcaacc
accacaacaacaactaccacaacaaccacctccagcacgacgacaaccactactactaca
cgtgtcaaaaaatttatagcagccgctgtccactctcacttcgatgactgcccagactcc
cacagccacttctgttttcatggcacatgccgctttctcatactggaggaaacacctgca
tgcgtatgtcatcctggctttgtaggtatgcgatgcgaacatgcagatctcttggctgtg
gtggcgtctaaccacaggcaacagaccgtggccaccatgctggtgttgtgtgtggtgggc
agtgttctactcatgctgctctgcactttactaaattgttggtggagacggggtggttgt
gggcgaggtaacaccatttcgtgttggtcggagaagcctaggagtattttgacgggtggg
acatcctgctgtcactcagaaacaggtattctggtgctacatttccatttttacacaact
ttttgctga

DBGET integrated database retrieval system