KEGG   Sinocyclocheilus rhinocerous: 107712863
Entry
107712863         CDS       T04916                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04912  GnRH signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107712863
   04012 ErbB signaling pathway
    107712863
   04310 Wnt signaling pathway
    107712863
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107712863
  09143 Cell growth and death
   04210 Apoptosis
    107712863
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107712863
   04530 Tight junction
    107712863
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107712863
   04621 NOD-like receptor signaling pathway
    107712863
   04625 C-type lectin receptor signaling pathway
    107712863
  09152 Endocrine system
   04912 GnRH signaling pathway
    107712863
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107712863
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107712863
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107712863
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB Fib_alpha FlaC_arch DUF3450 Jnk-SapK_ap_N NAM-associated TEX13
Other DBs
NCBI-GeneID: 107712863
NCBI-ProteinID: XP_016373714
LinkDB
Position
Unknown
AA seq 301 aa
METTFYDDSLNSAFSQHVSATFGYNHKALKHNMTLNLTDPAGNLKPHLRAKANDILTSPD
VGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPRNVTDEQEGFADGFVRALAELHHQH
MPSVTSAPQTTINNSMAPVSSMAGGAVYSSSMRSDPPVYADLNTFNPAISTANPAMNYTS
APPQHTVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRVAASKCR
KRKLERISRLEDKVKNLKSQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQT
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaaactactttctacgatgactctctaaacagcgctttctctcagcatgtcagcgct
acttttggatacaaccacaaggctctgaaacataacatgacgctgaatctgaccgaccca
gccggcaacctgaagccccacctgagggccaaagccaacgacatcctcacctcccccgac
gtggggctgctcaaactggcttcgccggagctggagcggctcatcatccagtccagcaac
ggcctgatcactacaacgccgactccgacccagtttctgtgtcccaggaacgtgacggac
gaacaggagggcttcgcggatggcttcgtgagggcactggccgagctgcatcaccagcac
atgcccagcgtcacctcggctccccagacgaccatcaacaacagcatggcacccgtttcg
tccatggcaggcggcgcggtgtacagttcctccatgcgctccgaccctccagtgtacgcg
gacctgaacactttcaaccccgccatcagcaccgccaaccccgcgatgaactacaccagc
gccccgccgcagcacaccgtccagcacccgcggcttcaggcgctgaaggaggagccccaa
acggtgcctgagatgcccggcgagacgccacctctctcccccatcgacatggagagccag
gagcggattaaagccgagagaaagcgcatgaggaaccgggtcgccgcgtccaaatgccgg
aagaggaaactggagaggatctcccggctggaggataaagtcaagaacctgaagtcccag
aactccgagctggcgtccaccgcaaacatgctgcgcgagcaagtggcccagctcaagcag
aaagtcatgaaccacgtcaacagcggctgccagcttatgttgacgcaacagctgcagacg
ttctga

KEGG   Sinocyclocheilus rhinocerous: 107721038
Entry
107721038         CDS       T04916                                 

Definition
(RefSeq) transcription factor AP-1-like isoform X1
  KO
K04448  transcription factor AP-1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04912  GnRH signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107721038
   04012 ErbB signaling pathway
    107721038
   04310 Wnt signaling pathway
    107721038
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107721038
  09143 Cell growth and death
   04210 Apoptosis
    107721038
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107721038
   04530 Tight junction
    107721038
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107721038
   04621 NOD-like receptor signaling pathway
    107721038
   04625 C-type lectin receptor signaling pathway
    107721038
  09152 Endocrine system
   04912 GnRH signaling pathway
    107721038
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107721038
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107721038
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107721038
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 Paralemmin Jnk-SapK_ap_N DUF4407 Seryl_tRNA_N DUF3450 ZapB
Other DBs
NCBI-GeneID: 107721038
NCBI-ProteinID: XP_016384372
UniProt: A0A673I6V9
LinkDB
Position
Unknown
AA seq 323 aa
MTGKMETPFYHDDSVPNFGQIPDYDRYQGHKIMSKKNNMPRHFSHSLGNASSLKLNSPSG
LGMSGNPNGSLMSSPDMNLLKLSSPDLEHLIIQSNQGLVTTSPAPNASANPFMYRNQATN
EQEGFADGFVKALADLHKQNQLVGAPMSPSSSIQGSYQRNLMPGADMPIYTNLSSYNPNQ
LPSSYPGGQMAYASPHGPQTRGPDAPQTVPEVPHPPGADPASSPPSLSPINLETQERIKA
ERKKLRNRIAASKCRKRKLERISRLEEKVKVLKTQNSDLASTASILREQVAQLKQKVMNH
VTNGCQIAVSSAGMAKSGESTSC
NT seq 972 nt   +upstreamnt  +downstreamnt
atgacgggtaagatggaaacgcctttctatcacgatgatagcgttcccaactttgggcaa
attccagattacgatcgataccaaggccacaagattatgagcaagaagaacaacatgccg
cgtcatttctcccacagcctgggaaacgcctcgagcctcaaactcaacagccccagcggt
ctgggcatgagcggcaatcccaacggctcgctgatgtcttctccagacatgaacctcctg
aagctgtcctctccagatctggagcacctgattatccagtctaaccagggactggttact
acaagcccggctccaaacgcgtctgctaatcccttcatgtaccgaaaccaggccacgaac
gagcaggagggattcgcagacggcttcgtcaaagctctggccgatctgcacaagcagaac
cagctggtgggggcccccatgtcgccctcctcctccatccagggctcctaccagaggaac
ctgatgccgggcgcagacatgcccatctacaccaacctgagcagctacaaccccaaccag
ctgccctcctcttaccccggcggccagatggcctacgcctcaccccacggccctcagact
cggggcccggacgctccgcagacggtgcccgaggtccctcacccgcccggggccgacccg
gccagctccccgccctcactctctcccatcaacctggagacccaggagcggatcaaggcg
gagcgcaagaagctgcggaaccgcatcgccgcctccaagtgccgcaagaggaagctggag
aggatctcgcggctggaggagaaggtcaaggtgctgaagacgcagaactcggacctggcc
tccaccgccagcatcctgagagagcaggtggctcagctcaaacagaaagtcatgaatcac
gtcactaatggctgccagatcgccgtcagctcagccggcatggccaagagtggcgagagc
accagctgctga

KEGG   Sinocyclocheilus rhinocerous: 107735627
Entry
107735627         CDS       T04916                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04912  GnRH signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107735627
   04012 ErbB signaling pathway
    107735627
   04310 Wnt signaling pathway
    107735627
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107735627
  09143 Cell growth and death
   04210 Apoptosis
    107735627
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107735627
   04530 Tight junction
    107735627
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107735627
   04621 NOD-like receptor signaling pathway
    107735627
   04625 C-type lectin receptor signaling pathway
    107735627
  09152 Endocrine system
   04912 GnRH signaling pathway
    107735627
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107735627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107735627
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107735627
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 Paralemmin Jnk-SapK_ap_N DUF4407 NBP1 Seryl_tRNA_N DUF3450 ZapB
Other DBs
NCBI-GeneID: 107735627
NCBI-ProteinID: XP_016402742
UniProt: A0A673FPP1
LinkDB
Position
Unknown
AA seq 285 aa
MPRHFSHSLGNASSLKLNSPSGLGMSGNPNGSLMSSPDMNLLKLSSPDLEHLIIQSNQGL
VTTSPAPNASANPFMYRNQATNEQEGFADGFVKALADLHKQNQLVGAPMSPSSSIQGSYQ
RNLMPGADMPIYTNLSSYNPNQLPSSYPGGQMAYASPHGPQTRGPDAPQTVPEVPHPPGA
DPASSPPSLSPINLETQERIKAERKKLRNRIAASKCRKRKLERISRLEEKVKVLKTQNSD
LASTASILREQVAQLKQKVMNHVTNGCQIAVSSAGMAKSGESTSC
NT seq 858 nt   +upstreamnt  +downstreamnt
atgccgcgtcatttctcccacagcctgggaaacgcctcgagcctcaaactcaacagcccc
agcggtctgggcatgagcggcaatcccaacggctcgctgatgtcttctccagacatgaac
ctcctgaagctgtcctctccagatctggagcacctgattatccagtctaaccagggactg
gttactacaagcccggctccaaacgcgtctgctaatcccttcatgtaccgaaaccaggcc
acgaacgagcaggagggattcgcagacggcttcgtcaaagctctggccgatctgcacaag
cagaaccagctggtgggggcccccatgtcgccctcctcctccatccagggctcctaccag
aggaacctgatgccgggcgcagacatgcccatctacaccaacctgagcagctacaacccc
aaccagctgccctcctcttaccccggcggccagatggcctacgcctcgccccacggccct
cagacccggggcccggacgctccgcagacggtgcccgaggtccctcacccgcccggggcc
gacccggccagctccccgccctcactctctcccatcaacctggagacccaggagcggatc
aaggcggagcgcaagaagctgcggaaccgcatcgccgcctccaagtgccgcaagaggaag
ctggagaggatctcgcggctggaggagaaggtcaaggtgctgaagacgcagaactcggac
ctggcctccaccgccagcatcctgagagagcaggtggctcagctcaaacagaaagtcatg
aatcacgtcactaatggctgccagatcgccgtcagctcagccggcatggccaagagtggc
gagagcaccagctgctga

KEGG   Sinocyclocheilus rhinocerous: 107739852
Entry
107739852         CDS       T04916                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04137  Mitophagy - animal
srx04210  Apoptosis
srx04310  Wnt signaling pathway
srx04510  Focal adhesion
srx04530  Tight junction
srx04620  Toll-like receptor signaling pathway
srx04621  NOD-like receptor signaling pathway
srx04625  C-type lectin receptor signaling pathway
srx04912  GnRH signaling pathway
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107739852
   04012 ErbB signaling pathway
    107739852
   04310 Wnt signaling pathway
    107739852
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107739852
  09143 Cell growth and death
   04210 Apoptosis
    107739852
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107739852
   04530 Tight junction
    107739852
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107739852
   04621 NOD-like receptor signaling pathway
    107739852
   04625 C-type lectin receptor signaling pathway
    107739852
  09152 Endocrine system
   04912 GnRH signaling pathway
    107739852
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107739852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107739852
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107739852
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB PspA_IM30 Fib_alpha FlaC_arch Jnk-SapK_ap_N NAM-associated TEX13
Other DBs
NCBI-GeneID: 107739852
NCBI-ProteinID: XP_016407549
LinkDB
Position
Unknown
AA seq 307 aa
METTFYDDSLNGAFSQHDSATFGYNHKVLKHNMTLNLTDPAGNLKPHLRAKANDILTSPD
VGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFADGFVRALAELHHQH
IPNVTSAPRTTINNSMAPVSSMAGGAVYSSSMRPDPPVYADLNTFNPAISTTNPAMNYTS
APPQHTVNTQLPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRV
AASKCRKRKLERISRLEDKVKTLKSQNSELASTANMLREQVAQLKQKVMNHVNSGCQLML
TQQLQTF
NT seq 924 nt   +upstreamnt  +downstreamnt
atggaaactactttctacgacgactctctaaacggcgctttctctcagcatgacagcgct
acttttggatacaaccacaaggttctgaaacacaacatgacgctgaatctgaccgacccc
gctggcaacctgaagccccacctgagggccaaagccaacgacatcctcacctcccccgac
gtggggctgctcaaactggcttcgccggagctggagcggctcatcatccagtccagcaac
ggcctgatcactacaacgccgactccgacccagtttctgtgtcccaagaacgtgacggac
gagcaggagggcttcgcggatggcttcgtgagggcactggccgagctgcatcaccagcac
attcccaacgtcacgtcggctccccgaaccaccatcaacaacagcatggcacccgtttcg
tccatggcaggtggcgcggtgtacagttcatccatgcgccccgacccgcccgtgtacgcg
gacctgaacactttcaaccccgccatcagcaccaccaacccagcgatgaactacacgagc
gccccgccgcagcacaccgtgaacacgcagctgcccgtccagcacccgcggcttcaggcg
ctgaaagaggagccccaaacggtgcccgagatgcccggcgagaccccacctctctccccc
atcgacatggagagccaggagcggattaaagccgagagaaagcggatgaggaaccgagtc
gccgcatccaaatgccggaagaggaaacttgagaggatctcccggctggaggataaagtc
aagaccctgaagtcccagaactccgagctggcgtccaccgcaaacatgctgcgcgagcaa
gtggcccagctcaagcagaaagtcatgaaccacgtcaacagcggctgccagcttatgttg
acgcaacagctgcagacgttctga

DBGET integrated database retrieval system