KEGG   Sinocyclocheilus rhinocerous: 107713127
Entry
107713127         CDS       T04916                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107713127
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107713127
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:srx04052]
    107713127
   00536 Glycosaminoglycan binding proteins [BR:srx00536]
    107713127
Cytokines and growth factors [BR:srx04052]
 Growth factors
  Growth factors (RTK binding)
   107713127
Glycosaminoglycan binding proteins [BR:srx00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107713127
SSDB
Motif
Pfam: FGF Fascin DUF799
Other DBs
NCBI-GeneID: 107713127
NCBI-ProteinID: XP_016374047
LinkDB
Position
Unknown
AA seq 154 aa
MLNLVLHRFYSQMPMADEFSSFHILYCRNGGYHLRIQPNGTVDASRQENDVYTLLKVKAV
KAGLVAIRGHETGLYLAMDKYGKLYGTVMLNDECYFIEKIEENHYNTYRSQRYQENGDWY
VGIKKNGWAKNGSKTHKGQNAIYFLPIPVDNSIQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atgttgaatcttgtgttgcaccgtttctactcccaaatgcctatggctgatgaattctca
agcttccacattctttactgcaggaatggaggataccatctccggatccaacctaacggg
actgtggacgcaagtcgacaagagaacgacgtttacactcttttaaaggtaaaagcagtg
aaagcaggattagtagccattaggggtcatgagactggactatacctggcaatggacaaa
tatggaaaactttatggcactgtcatgttgaacgatgagtgttacttcattgagaagata
gaggagaaccactacaacacataccgctcacagaggtatcaggagaacggagactggtac
gtggggatcaaaaagaatggatgggcaaaaaacggctccaaaacacacaagggccaaaat
gcaatctacttcctgccaattccagtggataacagcatacagtaa

DBGET integrated database retrieval system