KEGG   Sinocyclocheilus rhinocerous: 107713173
Entry
107713173         CDS       T04916                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107713173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107713173
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:srx03310]
    107713173
Transcription factors [BR:srx03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107713173
Nuclear receptors [BR:srx03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107713173
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107713173
NCBI-ProteinID: XP_016374092
UniProt: A0A673M0K9
LinkDB
Position
Unknown
AA seq 681 aa
MADPSLMGRNIQEPDVKTFKPFRMQHQQKVKEPLNIGENFSLLDESIADLNRGSGIQAPD
TFAMKMEQFSPMEKDRLDFPPYDYPDKETDGNERVIGDNTIDILKDLDLPDSLSDLNEFY
VADEAAFLSSLAVDDALLGESHFLKDTSPVVTGNSAACANVNGTGKLQQMVEASVNMPVI
KTEKDPDFIQLCTPGVIKQENERRSYCQMSGMGGPHGGPTALGDMGGQTYHYGANTASAV
SLPDQKPLFGLFPPLPTLSDGWVRGSGYGDPSGMQRANETVLPSTYPCSSSLARPEVSSS
SPSGSVKPSGNTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRARQNTDGQHNYL
CAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLMRLRGHSSSSEQAPALPDER
MCSLVPKAMPQLVPTMLSLLKAIEPEIIYAGYDSTIPDTSTRLMTTLNRLGGRQVVSAVK
WAKALPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGGMLCFAPDLVINEERMKL
PYMSDQCNQMLKISNELVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKE
LGKAIVKREENSSQNWQRFYQLTKLLDSMQEMVEGLLNFCFYTFVNKSLSVEFPEMLAEI
ISHQLPKFKDGSVKPLLFHQK
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggcagacccatccttaatgggacgtaacatacaagaaccagatgttaagacattcaaa
cctttcagaatgcagcaccagcaaaaggtaaaagagcccctcaacattggggagaacttt
tcgctcttggacgagagcattgcagacttaaatcgtggttctggcatccaggcccctgac
acttttgcaatgaaaatggagcagttttcccccatggagaaagataggctggactttcca
ccctacgactatccagataaggaaacggatggtaatgagagagtgattggagacaacacc
attgacatcctaaaggatctggacttacctgactccctatctgacctgaatgagttctac
gttgctgatgaggctgccttcctgtcctcattggcagtggatgatgccttgctgggagag
agccacttcctaaaggataccagccctgttgtcactggcaacagtgcagcctgtgcaaat
gtgaacggcacggggaaactgcagcagatggtggaagccagtgtcaacatgccggtcata
aagacagagaaagacccagactttatccagctgtgtacaccgggtgtcatcaaacaggag
aatgagaggcggagctactgtcagatgtcagggatgggtgggcctcacggtgggcccacc
gctttgggagatatgggcggacagacataccactacggagccaacaccgcctcagctgtg
agtttaccagatcagaaacctctttttggcctgtttcctcccctacctaccttaagtgac
ggctgggttcgaggaagtggatatggagatccgtctgggatgcagagagccaatgagaca
gtacttccgtccacctatccgtgcagcagctctttggccaggcctgaagtgagcagctcc
agtccatcaggatcagtcaagcccagcggaaacacccataagatctgcctggtgtgctcc
gatgaggcctctggatgtcattatggggtgctcacctgtggcagctgcaaggttttcttc
aaaagagctgtggagggatggagggcacgacaaaacacagatgggcagcacaactatctc
tgcgcaggaaggaacgattgcatcatcgacaagataagacggaaaaactgcccagcatgc
cgctttcgcaagtgtcttcaggccggcatgaacttggaagctcggaaaaacaagaaactg
atgcgattgcggggtcattcgtcctcaagtgagcaggccccggctctgcctgatgagcgc
atgtgttcgctggtgcccaaagccatgccccagctggtgcccaccatgctgtccctgctc
aaagccattgagcctgagatcatttacgcgggctacgacagcaccatcccagacacctcc
acccgcctcatgacgacgcttaaccgtctaggaggccgccaggtcgtctctgccgtcaag
tgggccaaagctcttcccggcttcagaaacctgcacctggatgaccagatgacgctcctg
cagtgctcctggctcttcctcatgtcctttggcttgggctggagatcctaccagcagtgt
aacggaggcatgctgtgtttcgctccagacctcgtcatcaatgaggagaggatgaaacta
ccctacatgagtgaccagtgtaaccagatgctgaagatctccaatgagctggtcaggctg
caggtgtcctacgacgagtatctctgcatgaaagtgctcctgctcctcagcacagtacca
aaggacggccttaaaagccaagctgtgtttgatgaaatccgcatgtcgtacatcaaggag
ctgggcaaagccattgttaaacgagaggagaactccagccagaactggcagaggttttac
cagctcacaaagcttttggattcaatgcaggagatggtggaggggcttctcaacttctgt
ttctacacatttgtgaataaatctctgagtgtggagtttcctgagatgctggcggagatc
atcagccatcagctaccaaaatttaaagacgggagtgttaagcctcttctgttccatcag
aaatga

DBGET integrated database retrieval system