KEGG   Sinocyclocheilus rhinocerous: 107713452Help
Entry
107713452         CDS       T04916                                 

Definition
(RefSeq) zinc finger and BTB domain-containing protein 16-A-like isoform X1
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:srx04121]
    107713452
Ubiquitin system [BR:srx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     107713452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 BTB zf-C2H2 zf-C2H2_jaz zf-met zf-C2H2_6 zf-Di19 zf-C2H2_2 zf-C2H2_11 MIX
Motif
Other DBs
NCBI-GeneID: 107713452
NCBI-ProteinID: XP_016374440
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
MDLTKMGAIHLQNPSHPTSLLQKANQMRLSGTLCDVVIMVDSQEFHAHRTVLACASKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKLEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASEENDTDVNMNENSADDADDRKIKYLKSTFISKKHSIQDAGHRHRLALVSMVD
KRSSESIQLGLSTVSPTKAAVEGLMSMGQSVLQGNMAQSFSNNLGNSSPFLDKIKTEMMQ
VDEDYQHDGGFPRNDSRQLRDTPGTPTRGSVITSARELHSTDSSADSHGDNSQVGLVNMA
SLADRHFASLCSIPSNHKSESMLPLPVSMASSLHVPSSLAMSMDFSAYGGLFHQSLIQRE
FLSKLGDFTANVKHEVQTQKERCEVCDMELPDNEAAEQHRKLHGGVKTFGCEFCGKQFLD
SLRLRMHMLSHSAGPKALVCDQCGAQFSKEDALEAHRQTHTGSDMAVFCLLCGKRFQTQK
ALQQHMEIHAGMRSYVCSECERTFPSHTALKRHLRSHTGDHPFECEFCGSCFRDESTLKG
HKRIHTGEKPYECNGCGKRFSLKHQLETHYRIHTGEKPFECKLCHQRSRDYSAMIKHLRT
HNGASPYQCTICQEYCPSLSSMQKHIKAHKPEDVPPDWRIEKTYLYLCYV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatttgactaaaatgggtgcgatccacctccagaaccccagccaccccacatcgctc
ctgcagaaggccaaccagatgcgcctctctgggacattgtgtgatgtggtcatcatggtc
gacagccaggagtttcatgcccacagaaccgtgctcgcatgtgctagtaagatgtttgag
atcctgttccaccgcaacagccaacattacactctggacttcctctcaccaaagaccttc
cagcagattctggagtacgcctacaccgccacgctccaagccaagctggaggacctggat
gacctgctctacgccgcagagattttagagatagaatacttggaggagcaatgtctgaag
atcttggaaaccattcaggcgtccgaagagaacgacacagacgtgaacatgaacgagaac
agcgcagatgatgccgatgaccgcaagatcaagtaccttaagagcacatttatctctaaa
aagcattccatacaggacgccggccatcgccatcgcttggcgctggtcagcatggtcgat
aagagatcttcagagtccatccaactgggtctttcaaccgtcagcccgactaaagcagcc
gtagagggcctgatgagcatggggcagtctgtcctccaaggaaacatggcccagagtttc
tcaaacaaccttggtaactcatctccatttttagataaaatcaagactgagatgatgcag
gtagatgaggactaccaacatgatggtggcttccccaggaacgactccaggcagctccgg
gacactcctggaaccccgaccagaggtagcgtcatcaccagcgcccgcgagctccactcc
accgatagttctgctgattcccatggagacaacagccaagtgggtctagtcaatatggcc
agtctggctgatagacatttcgcttcgctgtgctctatcccgtccaaccataagagtgaa
agcatgctgcccttgcctgtgtccatggcctcatcgctacatgtgccgtcctccctggcc
atgtcgatggatttcagtgcctatggggggctcttccatcagagcttgattcagagggag
ttcttaagcaagcttggggatttcacagcgaatgtaaagcatgaggtccaaacccagaaa
gaaagatgtgaggtgtgtgatatggagctgcctgataatgaagctgctgaacaacacagg
aagttgcatggtggagtgaagacctttggctgtgagttctgtggaaagcagttcctggac
agtttacgattgaggatgcacatgctgtctcattcagctggaccaaaagcactagtatgt
gatcagtgtggcgctcagttctccaaggaagacgccctggaagcccatcgacagactcac
acaggctcagacatggcagtgttttgtctcctatgtgggaagcgtttccagacccagaag
gctttgcagcagcacatggagattcacgccggcatgcgcagctacgtctgcagcgagtgc
gagcgcaccttcccgagccacacggcgctcaaacgccatcttcgctcgcacacaggtgac
cacccgttcgagtgcgagttctgcgggagctgcttccgtgacgagagcactctgaagggt
cacaagcgcatccacaccggagagaagccttatgaatgtaacggctgcggcaagaggttc
agcctcaagcaccagctggagacccactaccgcatccacacaggtgagaagccgtttgag
tgcaagctgtgccaccagcgctctcgggactactccgccatgatcaaacacctgcgtacc
cacaacggcgcttctccctaccagtgcaccatctgccaggagtactgccccagcctctcg
tccatgcagaagcacataaaggcccacaagcccgaggacgtgcccccagactggaggata
gagaagacctacctgtacctctgctatgtgtga

DBGET integrated database retrieval system