KEGG   Sinocyclocheilus rhinocerous: 107713552Help
Entry
107713552         CDS       T04916                                 

Gene name
hsd17b4
Definition
(RefSeq) peroxisomal multifunctional enzyme type 2
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00120  Primary bile acid biosynthesis
srx01040  Biosynthesis of unsaturated fatty acids
srx01100  Metabolic pathways
srx01212  Fatty acid metabolism
srx04146  Peroxisome
Module
srx_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    107713552 (hsd17b4)
   01040 Biosynthesis of unsaturated fatty acids
    107713552 (hsd17b4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107713552 (hsd17b4)
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     107713552 (hsd17b4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     107713552 (hsd17b4)
    4.2.1.119  enoyl-CoA hydratase 2
     107713552 (hsd17b4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR MaoC_dehydratas MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 107713552
NCBI-ProteinID: XP_016374586
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MSAPLSFDGRVVLVTGAGGGLGREYALAFGQRGAAVIVNDLGGDIKGGGRSSAAADKVVE
EIRAKGGKAVANYDSVEDGEKLIQTALDAFGRIDIVVNNAGILRDRSFARTSDADWDLIQ
RVHLRGSFLVTRAAWNHMKNQKFGRIIMTSSAAGIYGNFGQANYSAAKLGLLGLSNTLAI
EGQKYSIHCNTIAPTAGSRLTETVMPPDLVQSLRAEYVAPLVLWLCHEACQENGGLFEVG
AGWIGKLRWERSLGRTVRQKNKSMTPEAVRDAWNEICDFTDASKPASIQESLQTLVEVLS
RVEDEPGIRANPTGATAGTNPSSAVGQTLPEMSFSYTHMNCILYALGVGMSSREPDQLKF
LYEGHEDFSCLPTFGVIPAQSAMTGLGSIPGLNIDFTRLLHGEQYLEMFRALPTSGTLTS
RATVADVLDKGSGMVILLDVYTYSGRELVCYNQFSVFVVGAGGFGGKRTSQKAVVTAPLP
DRAPDTVIVDQTSRDQAALYRLSGDWNPLHIDPSFAAMGGKDAL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgcctttgagtttcgacggcagagtcgtgctggtgaccggagccggaggaggt
ttggggagggaatatgcgctggcgttcggtcagagaggagccgctgtcatcgtcaatgat
ctgggaggagatattaaaggaggtggcaggagctcagcagccgctgataaagtggtggag
gagatcagagctaaaggaggcaaagccgtggccaattacgattcagtggaagatggtgag
aagctcatccagacggcgctggacgcatttggccgaatagatattgtggtgaataacgcc
gggattctgcgggaccgatcattcgctaggaccagcgatgcagactgggacctgattcag
cgcgtgcacctgaggggctccttcctcgtcacgagggccgcctggaaccacatgaagaac
cagaagtttgggaggatcatcatgacgtcgtccgcggcgggaatctacgggaacttcggc
caggccaactacagcgcggccaagctaggtctgctgggtctctccaacacgctggccatc
gaaggccagaagtacagcatccactgcaacaccatcgctccgaccgcaggatcccgcctc
accgagaccgtcatgcctccagatctggtgcagtcgctgagggccgagtacgtggctccg
ctggtgctgtggctgtgtcatgaagcgtgtcaggagaacggagggctgttcgaggtcggc
gccggatggatcggcaaattgcgctgggagaggagtctgggccgaaccgtgcggcagaag
aacaagagcatgacgccggaggctgtgcgagacgcttggaacgagatctgtgacttcact
gatgccagcaaacccgccagcatccaggagtcgctgcagacgctggtggaggttctgtcc
agagtggaagatgaacctggaatcagagccaatccgaccggagcgaccgccggcacaaac
ccttcgtcggctgtgggacagacgctgccggagatgagcttctcgtacacacacatgaac
tgtattctgtacgctctgggagtggggatgtccagcagagagcctgaccaactcaagttc
ctctacgaaggccacgaggacttcagctgtctgcccacgtttggagtgattccggcccag
agcgccatgacgggcctcggcagcatcccaggcctcaacatcgacttcaccaggctgctg
cacggagagcagtatctggagatgttcagagcgctgcccacctcagggacgctgacgtct
cgggccacggtggcagatgtgctggataaagggtcaggaatggtcatcctgctggacgtt
tatacgtacagcgggcgtgagctggtgtgttataatcagttctcggtgttcgttgttggc
gctggaggattcggagggaagcggacgtcccagaaggctgtggtcacagctcctcttcca
gacagagctccagacactgtgattgtagatcagacatctagagatcaggcggctctgtac
cgactgagcggtgactggaacccgctgcacatcgaccccagtttcgccgcaatgggaggt
aaagacgctctttaa

DBGET integrated database retrieval system