KEGG   Sinocyclocheilus rhinocerous: 107713759
Entry
107713759         CDS       T04916                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04270  Vascular smooth muscle contraction
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107713759
   04012 ErbB signaling pathway
    107713759
   04370 VEGF signaling pathway
    107713759
   04371 Apelin signaling pathway
    107713759
   04068 FoxO signaling pathway
    107713759
   04150 mTOR signaling pathway
    107713759
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107713759
  09143 Cell growth and death
   04210 Apoptosis
    107713759
   04218 Cellular senescence
    107713759
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107713759
   04540 Gap junction
    107713759
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107713759
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107713759
  09152 Endocrine system
   04910 Insulin signaling pathway
    107713759
   04912 GnRH signaling pathway
    107713759
   04914 Progesterone-mediated oocyte maturation
    107713759
   04916 Melanogenesis
    107713759
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107713759
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107713759
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107713759
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107713759
Protein kinases [BR:srx01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107713759
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 107713759
NCBI-ProteinID: XP_016374849
UniProt: A0A673IUL1
LinkDB
Position
Unknown
AA seq 613 aa
MEQLQGAWRSITNGLGMKESVFESSCMSPVIQGVPCQHRTSDDSRTSRTIRVFLPNQQRT
VVNVRPGLTLHSCLIKALKVRGLQPECCAVFSLHPGQRSKKSRMDWNTDSTSLIGEELLV
EVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWT
NIRQLLLFPTPGESGTPSLPALTSRRMRESLTRNPSSFSSAYPPSGAALTQRLRSTSTPN
VCATVAVDSSQIEDAMRIHNSASSSPDQSPTGWNLHNIPTPAQRERAPSLNPQVKIRPRD
KRDSSYYWEIEANEVVLLNRIGSGSFGTVYKGKWHGDVAVKILKVTKPTPEQFEAFRNEV
AVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETNFQMFQLIDIARQTAQ
GMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSGSQQVEQTSGSILWMAP
EVIRMQDCNPYSFQSDVYSFGIVLFELMTGELPYSQIANRDQIIYMVGRGYLSPDLSKLY
KSCPKAMKRLVADCIKKSKDERPLFPQILSSIELLQHSLPKINRSASEPSLHRASQSEDI
SSFTLTSMKLPVF
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggagcagcttcagggagcatggagatccatcaccaacggtctgggaatgaaggagtct
gtgtttgagagctcatgcatgtctcctgtgatccaaggagtgccatgtcagcaccgcacc
tcagacgactccagaaccagccgcaccatccgagtcttcctacccaaccagcagcggacc
gtggtgaatgtgcggccaggcctgacgctccacagctgtctgatcaaagcgctgaaggtt
cgagggctccagccagagtgctgcgctgtcttcagtctccatccgggacagaggagcaag
aagtctcgtatggactggaacacagactctacctcactcattggggaggaacttctagtg
gaggttttggaccatgttcccttaactacacacaattttgttagaaaaacatttctgaaa
ttggctttctgcgacatatgccagaagttcctcttgaatggtttccgttgccaaacatgt
ggctacaagttccatgagcactgcagcacaaaagtgcccacaatgtgtgttgactggacc
aacatcagacaactgctattgtttccgactcctggcgagagtgggactccatctctccct
gcacttacatctcggagaatgagggaatccctgacgaggaaccctagcagtttctccagc
gcttaccccccgtctggagcggctctgacacagagactgcgctccacctccactcccaat
gtctgcgccacagtggctgtcgacagcagccagatcgaggatgccatgcgcattcacaat
tcagctagcagttctccggatcagagtccaacaggctggaacctgcacaatatacccacc
ccggcccagagagagcgggctccgtccctgaaccctcaggttaaaattcggccgagggat
aagagagactcgagctattactgggagattgaagctaacgaggtggtgctgctgaacagg
atcggctcgggctcctttggaaccgtatacaaagggaaatggcacggtgatgtggctgtg
aagatattaaaagtcaccaagccgacaccggagcagtttgaagccttccgcaacgaggtg
gcggttcttaggaaaaccagacatgtcaacatcctgttgttcatgggctacatgacaaaa
gacaatcttgcgattgtgacgcagtggtgtgaaggcagcagtctctacaaacacctccat
gtgcaagagaccaacttccagatgtttcagctgatagatatcgccagacagaccgctcag
ggcatggactatctacatgcaaaaaacatcatccaccgtgacatgaaatcaaacaacatc
ttcttacatgagggcctgacagtgaagatcggagattttgggctggccacagtgaaggcc
aggtggagcggttctcaacaggtggaacaaacatcgggatctattttatggatggcacct
gaggtgatccgaatgcaggactgcaacccgtacagcttccaatctgatgtgtattctttt
ggcattgtgctgtttgaattaatgactggggagctgccctactcacagatagctaaccga
gatcagatcatctacatggttggtcgaggatatctgtctccagacctcagtaagctctat
aagagttgtcctaaagccatgaagagactggtggctgactgtatcaagaagtccaaggac
gagaggcctcttttcccccagattctgtcctccattgagctgctgcagcattcgctgccc
aaaatcaaccgcagcgcctctgaaccctcgctgcacagagcgtcacagagtgaagacatc
agctccttcacactcacctccatgaagctgcccgtcttctag

KEGG   Sinocyclocheilus rhinocerous: 107742031
Entry
107742031         CDS       T04916                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04270  Vascular smooth muscle contraction
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107742031
   04012 ErbB signaling pathway
    107742031
   04370 VEGF signaling pathway
    107742031
   04371 Apelin signaling pathway
    107742031
   04068 FoxO signaling pathway
    107742031
   04150 mTOR signaling pathway
    107742031
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107742031
  09143 Cell growth and death
   04210 Apoptosis
    107742031
   04218 Cellular senescence
    107742031
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107742031
   04540 Gap junction
    107742031
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107742031
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107742031
  09152 Endocrine system
   04910 Insulin signaling pathway
    107742031
   04912 GnRH signaling pathway
    107742031
   04914 Progesterone-mediated oocyte maturation
    107742031
   04916 Melanogenesis
    107742031
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107742031
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107742031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107742031
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107742031
Protein kinases [BR:srx01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107742031
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like C1_2
Other DBs
NCBI-GeneID: 107742031
NCBI-ProteinID: XP_016410365
UniProt: A0A673IA30
LinkDB
Position
Unknown
AA seq 620 aa
MEHLQGSWKNISHGFGCKDSVFEDSCMSPTILKNFPYRRLSDGRIPDSKTSSTIRVYLPN
KQRTVVNVRAGMTLRNCLIKALKVRGLQPECCAVFKLHREHSFKKLRMDWSTDSSSLVGE
ELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLHGFRCQTCGYKFHEHCSTKVPTMC
VDWSNIRQLLLFPTPGENGTPSLPPLSSRRMHNSKFSFSSYHRYSTPNALSYISPMPCAG
VSLSRKVLSTSTPNVHMVSTLHETAAFQEALGRDESGSPTDCSRTPAPAHREKAPSNNTQ
EKRLRPREKRDSSYYWEIEATEVLLLSRIGSGSFGTVYKGKWHGDVAVKILKVRNPTPEQ
LQAFRNEVAVLRKTRHVNIVLFMGYMTRANLAIVTQWCEGSSLYKHLHVQETSFQMLQLM
DIARQTAQGMDYLHAKNIIHRDMKSNNIFLREGLTVKIGDFGLATVKARWSGSHRVEQPS
GSVLWMAPEVIRMQDSNPHSFQSDVYSYGIVLYELMTGELPYSGIGNRDQIIFMVGRGYL
TPDLSKLYKSCPKAMKRLVADCMQKSRDDRPLFPQILSSIELLQHSLPKINRSASEPSLH
RASHTEDISVCTLPLSAVFK
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggagcatcttcaagggtcctggaaaaacatcagtcatgggtttgggtgcaaagactct
gtgtttgaagattcctgcatgtctcccaccattctcaagaacttcccgtaccggagattg
tccgacggcagaatcccagactcgaaaactagcagcacgatccgcgtctacctgcccaac
aaacagcggactgtggtgaatgtgcgagcgggtatgacgctgcgcaactgcctcatcaaa
gccctgaaggtccgagggcttcagccagaatgctgtgcggttttcaagctccatcgagaa
cattcatttaagaagctgcgtatggattggagcactgactctagctcgctggtcggagag
gagctgctggtggaagtcttagatcacgtacccctgactacgcacaattttgtacggaaa
acgttcttgaagttggctttttgtgacatctgtcagaagtttcttttgcacggcttcaga
tgtcagacgtgcggctacaagtttcacgagcactgcagcaccaaagtgcccacgatgtgt
gtggactggagcaacatccgccagctcctgctgttccccactcctggagagaacgggact
ccgtcgctgcctcctctctcatcccggcgcatgcacaactctaaattctccttcagttcc
tatcacagatactccacgccaaacgctttaagctacatcagccccatgccgtgcgctggc
gtgtctctcagtcgtaaagtgctgtccacatccactcctaacgtgcacatggtgagcacg
ctccacgagactgctgcatttcaggaagccttggggcgagacgagtcagggagcccgacg
gactgctccagaaccccggctccggcgcacagggagaaagcaccttcgaacaacactcag
gagaaacgcctccgtcccagagagaagagagattccagctattactgggagatcgaggcc
acggaggtgcttctgctctccaggatcggctccgggtcttttggcacggtttacaaaggg
aagtggcacggcgatgttgctgtgaagattttaaaggtcaggaatcccacaccagagcag
ctacaggcctttcgtaatgaagtggctgttctcaggaagaccaggcacgtcaatatcgtt
ctgtttatgggatacatgaccagggcaaacttggccattgtgacgcagtggtgtgaagga
agcagcctctacaaacatctgcacgtgcaggagaccagcttccagatgctccagctgatg
gacatcgccagacagacggcgcagggcatggattaccttcatgcaaagaacatcatccat
cgagacatgaagtcaaacaatatcttcctgcgtgaagggttgacggtgaagatcggtgat
tttggtctggccacagtgaaagcgcggtggagtggctctcatcgagtggagcagccgtcc
ggctctgttctgtggatggctcctgaggtcatccggatgcaggacagtaatccgcacagt
tttcagtcggatgtgtactcgtacgggatcgtcctgtacgagctgatgacgggagaactg
ccttactctgggattggaaatagagatcagatcatcttcatggtggggagaggctatctg
acccctgacctcagtaaactctacaagagctgtcccaaagccatgaagagactggtggcc
gactgcatgcagaagtccagagacgaccggccgctgtttccacagatcctgtcctcaatc
gagctgctccagcactcgctgcccaagatcaaccgcagcgcgtccgagccgtcgctccac
agagcctcgcacaccgaggacatcagcgtctgcacactgccgctctcagctgtcttcaag
tga

KEGG   Sinocyclocheilus rhinocerous: 107758125
Entry
107758125         CDS       T04916                                 

Gene name
raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04012  ErbB signaling pathway
srx04068  FoxO signaling pathway
srx04140  Autophagy - animal
srx04150  mTOR signaling pathway
srx04210  Apoptosis
srx04218  Cellular senescence
srx04270  Vascular smooth muscle contraction
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
srx04510  Focal adhesion
srx04540  Gap junction
srx04625  C-type lectin receptor signaling pathway
srx04810  Regulation of actin cytoskeleton
srx04910  Insulin signaling pathway
srx04912  GnRH signaling pathway
srx04914  Progesterone-mediated oocyte maturation
srx04916  Melanogenesis
srx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107758125 (raf1)
   04012 ErbB signaling pathway
    107758125 (raf1)
   04370 VEGF signaling pathway
    107758125 (raf1)
   04371 Apelin signaling pathway
    107758125 (raf1)
   04068 FoxO signaling pathway
    107758125 (raf1)
   04150 mTOR signaling pathway
    107758125 (raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107758125 (raf1)
  09143 Cell growth and death
   04210 Apoptosis
    107758125 (raf1)
   04218 Cellular senescence
    107758125 (raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107758125 (raf1)
   04540 Gap junction
    107758125 (raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107758125 (raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107758125 (raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107758125 (raf1)
   04912 GnRH signaling pathway
    107758125 (raf1)
   04914 Progesterone-mediated oocyte maturation
    107758125 (raf1)
   04916 Melanogenesis
    107758125 (raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107758125 (raf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107758125 (raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107758125 (raf1)
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107758125 (raf1)
Protein kinases [BR:srx01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107758125 (raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Kdo
Other DBs
NCBI-GeneID: 107758125
NCBI-ProteinID: XP_016431280
UniProt: A0A673KZ21
LinkDB
Position
Unknown
AA seq 628 aa
MEHIQGAWKSISHGFGCKDSVFEESCMSPTILKNFPYRRLSDDGRIPDSKTSSTIRVYLP
NKQRTVVNVRPGMTLRNCLIKALKVRGLQPECCAVFKLHREHSFKKLRMDWSTDSTSLVG
EELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLHGFRCQTCGYKFHEHCSTKVPTM
CVDWSNIRQLLLFPTPGENGTPSLPPLSSRRMQNSKFSFSPYHRYSTPNALNYITPMPSP
GVSLSHKVLSTSTPNVHMVSTTQPVDEAAYQEALGRDESGSPQDQSPTEWSKTPAPAHRE
KAPSTNTQEKRIRPREKRDSSYYWEIEATEVVLLSRIGSGSFGTVYKGKWHGDVAVKILK
VTNPTPEQLQAFRNEVAVLRKTRHVNIVLFMGYMTKSNMAIVTQWCEGSSLYKHLHVQET
NFQMFQLMDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSG
SHRVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGVVLYELMTGELPYSMIGNRDQII
FMVGRGYLTPDLSKLYKSCPKAMKRLVADCIQKSKDDRPLFPQILSSIELLQHSLPKINR
SASEPSLHRAAHTEDINVCTLALSSAFK
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggagcatattcaaggggcctggaaaagcatcagtcacgggtttggatgcaaagactcg
gtatttgaagaatcctgcatgtctcccaccattctcaagaacttcccgtaccggagatta
tcagatgacgggagaatcccagactcgaaaactagcagcacaatccgcgtctacctgccc
aacaaacagcggactgtggtgaacgtgcgaccaggtatgacgctacgcaactgcctcatc
aaagccctgaaagtccgtgggcttcagccagaatgctgtgctgttttcaagcttcatcga
gaacattcatttaaaaagttgcgcatggattggagcactgattctacctcactggtcgga
gaggagctgctggttgaagtcttagatcacgtacccctgactacgcacaattttgtacga
aaaacgtttttgaagttggccttttgtgacatatgtcagaagtttcttttgcacggcttc
agatgtcagacgtgcggctacaagtttcacgagcactgcagcaccaaagtgcccacgatg
tgtgtggactggagcaacatccgacagctcctgctgttcccgactcccggagagaacggg
actccatcgctccctcccctctcatcccgtcgcatgcagaactcgaaattctccttcagt
ccctatcacagatactcgacgccaaatgctttaaactacatcacccccatgccgtccccg
ggtgtttctctcagtcataaagtgctgtccacatccacccccaacgtccacatggtgagc
accacccagccggtcgatgaagctgcttatcaggaagccttagggcgagatgaatccgga
agccctcaagatcagagcccgacggagtggtccaaaaccccggctccagctcacagggag
aaagcgccttcgaccaacactcaggaaaaacgcatccgtcctcgagagaagagagattcc
agctactattgggagatcgaggccactgaggtggttctgctctccaggatcggctcaggg
tctttcggcacagtttacaaagggaagtggcacggtgatgttgctgtgaagattttaaag
gtcacgaatcccacaccagagcagttacaggcctttcgcaacgaagtagctgttctcagg
aagaccaggcatgtcaatattgttttgtttatgggatacatgaccaagtcaaacatggcc
attgtgacgcagtggtgtgaaggaagcagcctctacaaacatctgcacgtgcaggagacc
aacttccagatgttccagctgatggacatcgccagacagacggctcagggcatggattac
ctacatgcaaagaatatcatccatcgagacatgaagtcaaataatatcttcctgcatgaa
gggttgacggtgaagatcggtgattttggtctggccacggtgaaggcgcggtggagcggc
tctcatcgagtggagcagccatctggctccattctgtggatggctcctgaggtcatccgg
atgcaggacaacaatccttacagttttcagtcggatgtgtactcgtacggtgtcgtcctg
tacgagctgatgacaggagaactgccttattctatgattggaaatcgagatcagatcatc
tttatggtggggagaggctatctgacccctgacctcagtaaactctacaagagctgtcct
aaagccatgaagagactcgtcgccgactgcatccagaagtccaaagacgacagaccgctg
tttccgcagatcctgtcctcgattgagctgctccagcactcgctccccaaaataaaccgc
agcgcgtccgagccgtcgctccacagggccgcgcacaccgaggacattaacgtctgcact
ctggcgctttcatccgccttcaagtga

DBGET integrated database retrieval system