KEGG   Sinocyclocheilus rhinocerous: 107713826
Entry
107713826         CDS       T04916                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
srx04060  Cytokine-cytokine receptor interaction
srx04068  FoxO signaling pathway
srx04144  Endocytosis
srx04218  Cellular senescence
srx04350  TGF-beta signaling pathway
srx04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107713826
   04350 TGF-beta signaling pathway
    107713826
   04068 FoxO signaling pathway
    107713826
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107713826
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107713826
  09143 Cell growth and death
   04218 Cellular senescence
    107713826
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107713826
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107713826
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107713826
Protein kinases [BR:srx01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107713826
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107713826
NCBI-ProteinID: XP_016374940
UniProt: A0A673J7A2
LinkDB
Position
Unknown
AA seq 562 aa
MAQYWLSLLCWVTFLISSAVMERSGVDGMHSLYNPIRIPQLCKFCDVEASDCKGTSTCES
NCSITSICAHAEEICVAIWRKSDDNNTIETLCHNPSEPLYGIMVENYNNTKCEIKKRMSN
RGPFHICSCNAEECNDILMFTLPIGPDPTNNQVVLVILVSLLPLLVLAVLVIASFYWYRM
YRRRKLDEWETKKPSKRKGPKGPLDCSDACAIMMDDDRSDSSSTHANNLNHNTEPLPIEL
DLQVGKGRFAEVYKAKLRQSRSEQFETVAVKIFPYEEYASWKNEKDIFSDIDLKHENILH
FLTAEERKVEKQYWLITAYHPRGNLQEYLTRHLISWEDLRLLGGSLAWGVAHLHSDHTPF
GRPKVPIVHRDLKSSNILVKNDLTCCLCDFGLGLRLDNSLSVDDLANSGQVGTARYMAPE
VLESRINLENIESFKQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGSKVREHPCVESMK
DNVLRDRGRPEIPSSWMKHQGVAAVCTTINECWDHDPEARLTAQCVAERFNEMDDDLDKL
STCSSSEEKIPEDCSVSVSDDK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggcgcaatattggctttctctgctctgttgggtgacttttttgatttcttcggctgtc
atggagcggagcggagtcgatgggatgcattctttatataatccaatacggattcctcaa
ctgtgtaagttctgtgacgtggaggcatccgactgtaaaggcaccagcacctgtgaaagc
aactgcagcatcacatccatctgtgcccatgccgaagaaatctgtgtggctatctggagg
aagagtgatgacaacaacacgattgagacgttgtgccacaatccatctgagcccctctac
ggtatcatggtggagaactacaacaacaccaagtgtgaaataaaaaagaggatgtcaaac
agaggccccttccacatctgctcctgcaacgccgaggagtgcaacgacatactgatgttc
acgctccctattggtccagaccccacaaataaccaggtggtgttggtgatcctggtcagt
ttgctgcccctcctggttctggctgtgctggtcatcgcctccttctactggtatcgcatg
taccgtcgccgcaaactcgatgagtgggagaccaagaagccgtccaaacgcaagggaccc
aaaggcccgttggactgtagcgacgcctgcgccatcatgatggacgatgaccgctccgac
agcagctccacgcacgccaacaacctcaaccacaacacagaacctctgcccatcgagctg
gaccttcaggtgggcaagggccgcttcgccgaggtttataaagccaagctgagacaaagc
cgctcggaacagtttgagacggtggcggtgaagatcttcccctacgaagagtacgcatcc
tggaagaacgaaaaggacatcttctcagacatcgatctgaagcacgagaacattctgcac
ttcctgacggcagaggagaggaaggtggagaaacagtactggctgatcaccgcctatcat
ccacgcgggaacctgcaggagtacctcacgcgacacctcatcagctgggaggatctgcgg
ctgctcgggggctcactcgcctggggtgtggctcatttgcatagtgaccacacccctttt
gggcggcccaaagtgcccatcgttcaccgagatctgaagagctctaacatcctggtgaag
aatgacctcacttgttgcctctgtgactttggacttggcctccgccttgacaactcgctg
tcagtggatgacttggccaacagtggacaggtgggtacagccaggtacatggctccagaa
gtgctggaatcaaggatcaaccttgagaacatcgagtcattcaagcaaaccgatgtctac
tccatggccctggtgctgtgggagatcacgtccaggtgtaacgccatcggagaggttaaa
gactacgaacctccatttggctctaaagtccgagagcacccctgtgtggagagcatgaaa
gacaatgtgctgagagaccggggcagaccagagattcccagcagctggatgaaacaccag
ggtgtggctgcagtctgtaccaccatcaacgagtgctgggatcacgaccctgaagcccgg
ctcacggcacagtgtgtggccgaacgcttcaacgagatggacgacgacctagacaagttg
tcaacctgcagcagctctgaggagaagattccagaagattgctccgtgagcgtgagcgat
gacaaatga

DBGET integrated database retrieval system